Property Summary

NCBI Gene PubMed Count 18
PubMed Score 12.09
PubTator Score 20.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 2.37305631897538E-12
ovarian cancer 8492 7.90964583305851E-8
psoriasis 6685 2.4988832255615E-7
acute quadriplegic myopathy 1157 4.27194417407921E-6
posterior fossa group A ependymoma 1511 1.43253568559361E-5
adrenocortical carcinoma 1427 1.87534119760293E-4
group 4 medulloblastoma 1875 2.72241342636047E-4
breast carcinoma 1614 3.62763991676151E-4
interstitial cystitis 2299 0.00242861262151053
non-inflammatory breast cancer 208 0.00449465890168695
active Crohn's disease 918 0.00731676055955827
primary Sjogren syndrome 789 0.0097418623425399
atypical teratoid / rhabdoid tumor 4369 0.0207564182695035
cutaneous lupus erythematosus 1056 0.0211897915961303
subependymal giant cell astrocytoma 2287 0.0267745077087245
pilocytic astrocytoma 3086 0.0301501339630007
Disease Target Count Z-score Confidence
Spindle cell sarcoma 2 3.232 1.6

Expression

Synonym

Accession Q04725 B4DE03 E9PEV7 F8WCH2 Q8WVY0 Q9Y6S0
Symbols ESG
ESG2
GRG2

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG

Gene RIF (1)

PMID Text
19939918 Immunofluorescence analysis showed that TLE2 and RTA were colocalized in the same nuclear compartment in KSHV-infected cells.

AA Sequence

MYPQGRHPTPLQSGQPFKFSILEICDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGL      1 - 70
NIEMHKQAEIVKRLSGICAQIIPFLTQEHQQQVLQAVERAKQVTVGELNSLIGQQLQPLSHHAPPVPLTP     71 - 140
RPAGLVGGSATGLLALSGALAAQAQLAAAVKEDRAGVEAEGSRVERAPSRSASPSPPESLVEEERPSGPG    141 - 210
GGGKQRADEKEPSGPYESDEDKSDYNLVVDEDQPSEPPSPATTPCGKVPICIPARRDLVDSPASLASSLG    211 - 280
SPLPRAKELILNDLPASTPASKSCDSSPPQDASTPGPSSASHLCQLAAKPAPSTDSVALRSPLTLSSPFT    281 - 350
TSFSLGSHSTLNGDLSVPSSYVSLHLSPQVSSSVVYGRSPVMAFESHPHLRGSSVSSSLPSIPGGKPAYS    351 - 420
FHVSADGQMQPVPFPSDALVGAGIPRHARQLHTLAHGEVVCAVTISGSTQHVYTGGKGCVKVWDVGQPGA    421 - 490
KTPVAQLDCLNRDNYIRSCKLLPDGRSLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAVSPDAK    491 - 560
VCFSCCSDGNIVVWDLQNQTMVRQFQGHTDGASCIDISDYGTRLWTGGLDNTVRCWDLREGRQLQQHDFS    561 - 630
SQIFSLGHCPNQDWLAVGMESSNVEILHVRKPEKYQLHLHESCVLSLKFASCGRWFVSTGKDNLLNAWRT    631 - 700
PYGASIFQSKESSSVLSCDISRNNKYIVTGSGDKKATVYEVVY                               701 - 743
//

Text Mined References (22)

PMID Year Title
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22304967 2012 XIAP monoubiquitylates Groucho/TLE to promote canonical Wnt signaling.
19939918 2010 Cellular corepressor TLE2 inhibits replication-and-transcription- activator-mediated transactivation and lytic reactivation of Kaposi's sarcoma-associated herpesvirus.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19460168 2009 Groucho binds two conserved regions of LEF-1 for HDAC-dependent repression.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18254933 2008 The Groucho/TLE/Grg family of transcriptional co-repressors.
17041588 2006 CUL4-DDB1 ubiquitin ligase interacts with multiple WD40-repeat proteins and regulates histone methylation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
More...