Property Summary

NCBI Gene PubMed Count 18
PubMed Score 13.39
PubTator Score 20.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
active Crohn's disease -1.143 7.3e-03
acute quadriplegic myopathy -1.096 4.3e-06
adrenocortical carcinoma -1.060 1.9e-04
Astrocytoma, Pilocytic 1.100 3.2e-02
atypical teratoid / rhabdoid tumor -1.300 2.1e-02
Breast cancer -1.100 3.9e-05
breast carcinoma -1.100 3.6e-04
cutaneous lupus erythematosus -1.400 2.1e-02
ependymoma -1.600 6.3e-05
group 3 medulloblastoma 2.300 1.6e-02
interstitial cystitis -1.800 2.4e-03
non-small cell lung cancer -1.183 2.4e-12
ovarian cancer -1.400 7.9e-08
primary Sjogren syndrome -1.800 9.7e-03
psoriasis -1.300 2.5e-07
subependymal giant cell astrocytoma -2.173 3.1e-02

Protein-protein Interaction (12)

Gene RIF (1)

AA Sequence

MYPQGRHPTPLQSGQPFKFSILEICDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGL      1 - 70
NIEMHKQAEIVKRLSGICAQIIPFLTQEHQQQVLQAVERAKQVTVGELNSLIGQQLQPLSHHAPPVPLTP     71 - 140
RPAGLVGGSATGLLALSGALAAQAQLAAAVKEDRAGVEAEGSRVERAPSRSASPSPPESLVEEERPSGPG    141 - 210
GGGKQRADEKEPSGPYESDEDKSDYNLVVDEDQPSEPPSPATTPCGKVPICIPARRDLVDSPASLASSLG    211 - 280
SPLPRAKELILNDLPASTPASKSCDSSPPQDASTPGPSSASHLCQLAAKPAPSTDSVALRSPLTLSSPFT    281 - 350
TSFSLGSHSTLNGDLSVPSSYVSLHLSPQVSSSVVYGRSPVMAFESHPHLRGSSVSSSLPSIPGGKPAYS    351 - 420
FHVSADGQMQPVPFPSDALVGAGIPRHARQLHTLAHGEVVCAVTISGSTQHVYTGGKGCVKVWDVGQPGA    421 - 490
KTPVAQLDCLNRDNYIRSCKLLPDGRSLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAVSPDAK    491 - 560
VCFSCCSDGNIVVWDLQNQTMVRQFQGHTDGASCIDISDYGTRLWTGGLDNTVRCWDLREGRQLQQHDFS    561 - 630
SQIFSLGHCPNQDWLAVGMESSNVEILHVRKPEKYQLHLHESCVLSLKFASCGRWFVSTGKDNLLNAWRT    631 - 700
PYGASIFQSKESSSVLSCDISRNNKYIVTGSGDKKATVYEVVY                               701 - 743
//

Text Mined References (22)

PMID Year Title