Property Summary

NCBI Gene PubMed Count 64
Grant Count 11
R01 Count 5
Funding $981,059.83
PubMed Score 95.56
PubTator Score 54.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
urothelial carcinoma -1.300 0.039
osteosarcoma 1.426 0.000
group 4 medulloblastoma 1.800 0.000
cystic fibrosis 1.707 0.000
astrocytoma 1.100 0.042
tuberculosis and treatment for 3 months -1.300 0.000
lung cancer 1.300 0.001
breast carcinoma -1.100 0.000
psoriasis -1.200 0.000
lung carcinoma 1.400 0.000
ductal carcinoma in situ -1.100 0.030
invasive ductal carcinoma -1.300 0.010
ovarian cancer 1.400 0.012

Gene RIF (32)

PMID Text
26763127 Data suggest TLE1 is highly expressed in macrophages cultured in vitro, in macrophages of atherosclerotic plaques, and in macrophages of visceral adipose tissue from obese women; expression of TLE1 is up-regulated upon macrophage activation.
25446087 TLE1 has a role in regulating epithelial-to-mesenchymal transition in A549 cells through its repressive effect on E-cadherin
24596249 TCF/TLE tetramer complex promotes structural transitions of chromatin to mediate repression.
24487024 GrG1 is involved in pancreatic cell differentiation, establishing a monohormonal beta cell identity. Grg1 is the predominant Groucho expressed in human beta-cells but acts functionally similarly to Grg3.
24422953 There was no difference in TLE-1 staining between different subtypes of synovial sarcoma
23775085 signaling and increases the expression of recombinant recognition sequence binding protein at the Jkappa site (RBP-J) and transducin-like enhancer of Split (TLE).
23333304 HIV-1 Vif upregulates the expression of transducin-like enhancer of split 1 homolog protein (TLE1) in Vif-expression T cells
23287123 Although molecular confirmation is the diagnostic gold standard for synovial sarcoma, TLE1, in view of its high sensitivity may be a useful marker within the optimal IHC panel comprising EMA, BCL2, MIC2, CD34 and CK7
23197007 highly specific biomarker for synovial sarcoma
22952044 TLE1 is selectively upregulated in invasive breast tumors relative to noninvasive ductal carcinoma in situ and normal mammary epithelial tissues.
More...

AA Sequence

MFPQSRHPTPHQAAGQPFKFTIPESLDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYG      1 - 70
LNIEMHKQTEIAKRLNTICAQVIPFLSQEHQQQVAQAVERAKQVTMAELNAIIGQQQLQAQHLSHGHGPP     71 - 140
VPLTPHPSGLQPPGIPPLGGSAGLLALSSALSGQSHLAIKDDKKHHDAEHHRDREPGTSNSLLVPDSLRG    141 - 210
TDKRRNGPEFSNDIKKRKVDDKDSSHYDSDGDKSDDNLVVDVSNEDPSSPRASPAHSPRENGIDKNRLLK    211 - 280
KDASSSPASTASSASSTSLKSKEMSLHEKASTPVLKSSTPTPRSDMPTPGTSATPGLRPGLGKPPAIDPL    281 - 350
VNQAAAGLRTPLAVPGPYPAPFGMVPHAGMNGELTSPGAAYASLHNMSPQMSAAAAAAAVVAYGRSPMVG    351 - 420
FDPPPHMRVPTIPPNLAGIPGGKPAYSFHVTADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAV    421 - 490
TISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLA    491 - 560
APTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTK    561 - 630
LWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQLHLHESC    631 - 700
VLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY    701 - 770
//

Text Mined References (73)

PMID Year Title
26763127 2016 Transducin-like enhancer of split-1 is expressed and functional in human macrophages.
25446087 2014 TLE1 promotes EMT in A549 lung cancer cells through suppression of E-cadherin.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24596249 2014 Molecular functions of the TLE tetramerization domain in Wnt target gene repression.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
24487024 2014 Grg3/TLE3 and Grg1/TLE1 induce monohormonal pancreatic ?-cells while repressing ?-cell functions.
24422953 2013 Reappraisal of TLE-1 immunohistochemical staining and molecular detection of SS18-SSX fusion transcripts for synovial sarcoma.
23775085 2013 Increased cAMP in monocytes augments Notch signaling mechanisms by elevating RBP-J and transducin-like enhancer of Split (TLE).
23287123 2012 Immunohistochemical validation of TLE1, a novel marker, for synovial sarcomas.
23197007 2013 Specificity of TLE1 expression in unclassified high-grade sarcomas for the diagnosis of synovial sarcoma.
More...