Property Summary

NCBI Gene PubMed Count 66
PubMed Score 106.90
PubTator Score 54.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytoma 1.100 4.2e-02
breast carcinoma -1.100 1.6e-04
cystic fibrosis 1.409 3.5e-06
ductal carcinoma in situ -1.100 3.0e-02
group 4 medulloblastoma 1.300 1.6e-03
invasive ductal carcinoma -1.300 1.0e-02
lung cancer 1.300 8.3e-04
lung carcinoma 1.400 2.5e-18
osteosarcoma 1.426 1.1e-07
ovarian cancer 1.400 1.2e-02
psoriasis -1.100 1.1e-11
tuberculosis -1.200 4.5e-04
urothelial carcinoma -1.300 3.9e-02

Protein-protein Interaction (13)

Gene RIF (34)

AA Sequence

MFPQSRHPTPHQAAGQPFKFTIPESLDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYG      1 - 70
LNIEMHKQTEIAKRLNTICAQVIPFLSQEHQQQVAQAVERAKQVTMAELNAIIGQQQLQAQHLSHGHGPP     71 - 140
VPLTPHPSGLQPPGIPPLGGSAGLLALSSALSGQSHLAIKDDKKHHDAEHHRDREPGTSNSLLVPDSLRG    141 - 210
TDKRRNGPEFSNDIKKRKVDDKDSSHYDSDGDKSDDNLVVDVSNEDPSSPRASPAHSPRENGIDKNRLLK    211 - 280
KDASSSPASTASSASSTSLKSKEMSLHEKASTPVLKSSTPTPRSDMPTPGTSATPGLRPGLGKPPAIDPL    281 - 350
VNQAAAGLRTPLAVPGPYPAPFGMVPHAGMNGELTSPGAAYASLHNMSPQMSAAAAAAAVVAYGRSPMVG    351 - 420
FDPPPHMRVPTIPPNLAGIPGGKPAYSFHVTADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAV    421 - 490
TISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLA    491 - 560
APTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTK    561 - 630
LWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQLHLHESC    631 - 700
VLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY    701 - 770
//

Text Mined References (75)

PMID Year Title