Property Summary

Ligand Count 1
NCBI Gene PubMed Count 210
PubMed Score 287.18
PubTator Score 221.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Cholestasis 155
Osteoporosis 363
Abnormal skeletal development 60
Abnormality of the fingernails 51
Absent frontal sinuses 8
Acquired scoliosis 281
Acro-Osteolysis 12
Acroosteolysis dominant type 1
Alagille Syndrome 2 1
Angle class 2 malocclusion 57
Angle class 3 malocclusion 57
Anteverted nostril 191
Aplasia of frontal sinus 8
Arnold Chiari Malformation 11
Arthralgia 90
Atrial Septal Defects 85
Biconcave vertebral bodies 9
Big calvaria 147
Bone pain 42
Brachydactyly 156
Brachyonychia 6
Broad forehead 59
Bushy eyebrows 49
Byzanthine arch palate 194
Cervical instability 1
Chubby cheeks 50
Coarse facial features 108
Collapse of vertebra 14
Compression fracture of vertebral column 14
Conductive hearing loss 123
Congenital Epicanthus 177
Congenital deafness 185
Congenital dislocation of radial head 14
Crowded carpal bones 1
Cryptorchidism 296
Curvature of spine 282
Cystic kidney 30
Deafness 198
Decreased calcification of skull 10
Defect of skull ossification 10
Diabetes Mellitus, Non-Insulin-Dependent 145
Downturned corners of mouth 48
Downward slant of palpebral fissure 158
Early tooth exfoliation 17
Elongated sella turcica 1
Failure to gain weight 365
Fleshy earlobes 8
Foot acroosteolysis 5
Frequent fractures 53
Full cheeks 50
Generalized hirsutism 36
Generalized osteopenia 99
Gingival Diseases 19
Hearing Loss, Partial 185
Heart Septal Defects 24
Hernia, Inguinal 89
Hirsutism 47
Hydrocephalus 152
Hyperplasia of cheeks 50
Hypertrophy of cheeks 50
Hypoplastic 5th lumbar vertebrae 1
Hypoplastic mandible condyle 275
Hypoplastic toes 29
Increased fracture rate 53
Increased head circumference 147
Increased size of cranium 147
Increased size of skull 147
Joint hyperflexibility 78
Joint laxity 54
Kidney Failure 111
Knee joint valgus deformity 56
Kyphoscoliosis deformity of spine 60
Long eyelashes 37
Long narrow head 75
Long philtrum 137
Low set ears 181
Lytic lesion 32
Malocclusion 57
Mammary Neoplasms 425
Mandibular hypoplasia 275
Micrognathism 275
Microstomia 78
Narrow cranium shape 75
Narrow head shape 75
Narrow skull shape 75
Neuroectodermal Tumor, Primitive 8
Open Bite 21
Orbital separation excessive 244
Osteochondrodysplasias 72
Osteopenia 99
Partial absence of toe 1
Patent ductus arteriosus 90
Pathological fracture 20
Pediatric failure to thrive 365
Penile hypospadias 106
Periodontal Diseases 21
Peripheral pulmonary artery stenosis 14
Platybasia 13
Premature tooth loss 17
Prominent back of the head 21
Prominent occiput 21
Puffy cheeks 50
Renal Insufficiency 90
Renal cyst 30
Renal failure in adulthood 76
Renal tubular acidosis 24
Short distal phalanges 50
Short neck 140
Short stature 531
Squamous cell carcinoma of esophagus 77
Structure of wormian bone 24
Synophrys 40
Tall lumbar vertebral bodies 1
Telecanthus 62
Thickened facial skin with coarse facial features 108
Thin lips 49
Triangular face 58
Turridolichocephaly 75
Umbilical hernia 93
Uterine Cervical Neoplasm 25
Varying degree of multiple fractures 53
Wide nose 35
hearing impairment 199
periodontitis 293
Disease Target Count Z-score Confidence
Cancer 2499 4.529 2.3
Spondylocostal dysostosis 12 3.127 1.6

Expression

  Differential Expression (22)

Disease log2 FC p
lung cancer -1.800 5.6e-03
glioblastoma 1.100 4.8e-03
acute quadriplegic myopathy 1.179 3.6e-04
astrocytic glioma 1.200 1.6e-02
Astrocytoma, Pilocytic 1.400 3.9e-04
atypical teratoid / rhabdoid tumor 1.100 1.5e-04
autosomal dominant Emery-Dreifuss muscul... 1.360 1.0e-02
COPD -1.100 2.1e-03
Down syndrome 1.200 1.0e-02
Duchenne muscular dystrophy 1.446 3.1e-07
ependymoma 1.400 1.3e-02
group 3 medulloblastoma -1.500 4.0e-03
juvenile dermatomyositis 1.446 2.3e-11
lung carcinoma -2.100 2.4e-43
malignant mesothelioma -1.600 1.8e-06
medulloblastoma, large-cell -2.300 5.5e-04
osteosarcoma -2.243 3.2e-07
ovarian cancer -1.200 1.1e-04
pediatric high grade glioma 1.100 1.6e-07
pituitary cancer -1.600 3.7e-05
psoriasis 1.100 1.2e-03
urothelial carcinoma -1.300 2.6e-02

 CSPA Cell Line (4)

Protein-protein Interaction (1)

Gene RIF (180)

AA Sequence

MPALRPALLWALLALWLCCAAPAHALQCRDGYEPCVNEGMCVTYHNGTGYCKCPEGFLGEYCQHRDPCEK      1 - 70
NRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSRPCLNGGTCHMLSRDTYECTCQVGFTGK     71 - 140
ECQWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKCETDVNECDIPGHCQHGGTCLNLPGSYQCQCP    141 - 210
QGFTGQYCDSLYVPCAPSPCVNGGTCRQTGDFTFECNCLPGFEGSTCERNIDDCPNHRCQNGGVCVDGVN    211 - 280
TYNCRCPPQWTGQFCTEDVDECLLQPNACQNGGTCANRNGGYGCVCVNGWSGDDCSENIDDCAFASCTPG    281 - 350
STCIDRVASFSCMCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGADCTEDVDECA    351 - 420
MANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCEMDINECHSDPCQNDATCLDKIGGFTCLCMPGFKGVH    421 - 490
CELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTPCLNGAKCIDHPNGYECQCAT    491 - 560
GFTGVLCEENIDNCDPDPCHHGQCQDGIDSYTCICNPGYMGAICSDQIDECYSSPCLNDGRCIDLVNGYQ    561 - 630
CNCQPGTSGVNCEINFDDCASNPCIHGICMDGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCING    631 - 700
VNGFRCICPEGPHHPSCYSQVNECLSNPCIHGNCTGGLSGYKCLCDAGWVGINCEVDKNECLSNPCQNGG    701 - 770
TCDNLVNGYRCTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDISGYTCHCVLPYTGKNCQTVLAPCSPN    771 - 840
PCENAAVCKESPNFESYTCLCAPGWQGQRCTIDIDECISKPCMNHGLCHNTQGSYMCECPPGFSGMDCEE    841 - 910
DIDDCLANPCQNGGSCMDGVNTFSCLCLPGFTGDKCQTDMNECLSEPCKNGGTCSDYVNSYTCKCQAGFD    911 - 980
GVHCENNINECTESSCFNGGTCVDGINSFSCLCPVGFTGSFCLHEINECSSHPCLNEGTCVDGLGTYRCS    981 - 1050
CPLGYTGKNCQTLVNLCSRSPCKNKGTCVQKKAESQCLCPSGWAGAYCDVPNVSCDIAASRRGVLVEHLC   1051 - 1120
QHSGVCINAGNTHYCQCPLGYTGSYCEEQLDECASNPCQHGATCSDFIGGYRCECVPGYQGVNCEYEVDE   1121 - 1190
CQNQPCQNGGTCIDLVNHFKCSCPPGTRGLLCEENIDDCARGPHCLNGGQCMDRIGGYSCRCLPGFAGER   1191 - 1260
CEGDINECLSNPCSSEGSLDCIQLTNDYLCVCRSAFTGRHCETFVDVCPQMPCLNGGTCAVASNMPDGFI   1261 - 1330
CRCPPGFSGARCQSSCGQVKCRKGEQCVHTASGPRCFCPSPRDCESGCASSPCQHGGSCHPQRQPPYYSC   1331 - 1400
QCAPPFSGSRCELYTAPPSTPPATCLSQYCADKARDGVCDEACNSHACQWDGGDCSLTMENPWANCSSPL   1401 - 1470
PCWDYINNQCDELCNTVECLFDNFECQGNSKTCKYDKYCADHFKDNHCDQGCNSEECGWDGLDCAADQPE   1471 - 1540
NLAEGTLVIVVLMPPEQLLQDARSFLRALGTLLHTNLRIKRDSQGELMVYPYYGEKSAAMKKQRMTRRSL   1541 - 1610
PGEQEQEVAGSKVFLEIDNRQCVQDSDHCFKNTDAAAALLASHAIQGTLSYPLVSVVSESLTPERTQLLY   1611 - 1680
LLAVAVVIILFIILLGVIMAKRKRKHGSLWLPEGFTLRRDASNHKRREPVGQDAVGLKNLSVQVSEANLI   1681 - 1750
GTGTSEHWVDDEGPQPKKVKAEDEALLSEEDDPIDRRPWTQQHLEAADIRRTPSLALTPPQAEQEVDVLD   1751 - 1820
VNVRGPDGCTPLMLASLRGGSSDLSDEDEDAEDSSANIITDLVYQGASLQAQTDRTGEMALHLAARYSRA   1821 - 1890
DAAKRLLDAGADANAQDNMGRCPLHAAVAADAQGVFQILIRNRVTDLDARMNDGTTPLILAARLAVEGMV   1891 - 1960
AELINCQADVNAVDDHGKSALHWAAAVNNVEATLLLLKNGANRDMQDNKEETPLFLAAREGSYEAAKILL   1961 - 2030
DHFANRDITDHMDRLPRDVARDRMHHDIVRLLDEYNVTPSPPGTVLTSALSPVICGPNRSFLSLKHTPMG   2031 - 2100
KKSRRPSAKSTMPTSLPNLAKEAKDAKGSRRKKSLSEKVQLSESSVTLSPVDSLESPHTYVSDTTSSPMI   2101 - 2170
TSPGILQASPNPMLATAAPPAPVHAQHALSFSNLHEMQPLAHGASTVLPSVSQLLSHHHIVSPGSGSAGS   2171 - 2240
LSRLHPVPVPADWMNRMEVNETQYNEMFGMVLAPAEGTHPGIAPQSRPPEGKHITTPREPLPPIVTFQLI   2241 - 2310
PKGSIAQPAGAPQPQSTCPPAVAGPLPTMYQIPEMARLPSVAFPTAMMPQQDGQVAQTILPAYHPFPASV   2311 - 2380
GKYPTPPSQHSYASSNAAERTPSHSGHLQGEHPYLTPSPESPDQWSSSSPHSASDWSDVTTSPTPGGAGG   2381 - 2450
GQRGPGTHMSEPPHNNMQVYA                                                    2451 - 2471
//

Text Mined References (215)

PMID Year Title