Property Summary

NCBI Gene PubMed Count 182
Grant Count 177
R01 Count 115
Funding $15,943,364.9
PubMed Score 253.67
PubTator Score 221.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
astrocytoma 3.100 0.001
glioblastoma 1.800 0.002
urothelial carcinoma -1.300 0.026
malignant mesothelioma -3.100 0.000
ependymoma 2.100 0.000
psoriasis -3.100 0.000
osteosarcoma -2.243 0.000
group 4 medulloblastoma -2.900 0.000
atypical teratoid / rhabdoid tumor 2.700 0.000
medulloblastoma, large-cell -2.700 0.001
Duchenne muscular dystrophy 1.446 0.000
autosomal dominant Emery-Dreifuss muscul... 1.360 0.010
juvenile dermatomyositis 1.446 0.000
acute quadriplegic myopathy 1.179 0.000
lung cancer -2.300 0.000
pediatric high grade glioma 1.700 0.001
pilocytic astrocytoma 1.400 0.001
COPD -1.100 0.002
lung carcinoma -2.100 0.000
ovarian cancer 1.600 0.001
pituitary cancer -1.600 0.000
Down syndrome 1.200 0.010

Synonym

Accession Q04721 Q5T3X7 Q99734 Q9H240 Notch 2
Symbols hN2
AGS2
HJCYS

Gene

PDB

2OO4  

 GWAS Trait (1)

Gene RIF (152)

PMID Text
26640406 Notch2 and Notch3 inhibited both cell proliferation and cell apoptosis in BeWo and JAR trophoblast cell lines.
26427670 suggest that Notch2 has an essential role in the cell growth, invasion, and migration of SACC. Notch2 may therefore be a potential target gene for the treatment of SACC by interfering with cell growth and metastasis
26252838 These findings suggested that the NOTCH2 signaling may confer aggressive behavior and immature morphology in human hepatocellular carcinoma cells.
26165719 A functional polymorphism in the premiR146a gene influences the prognosis of glioblastoma multiforme by interfering with the balance between Notch1 and Notch2
26041884 Notch signaling sustains chronic lymphocytic leukemia cell survival by promoting Mcl-1 expression and eIF4E activity, and given the oncogenic role of these factors, underscores the therapeutic potential of Notch inhibition in chronic lymphocytic leukemia.
26041881 Results suggest that Notch2 pathway and miR-23b interplay in a reciprocal regulation loop in gastric cancer cells and this axis plays an important role in gastric carcinogenesis.
26018735 NOTCH2 inhibition triggers the Epstein-Barr virus lytic cycle and cell apoptosis; and NOTCH2 inhibition may represent an appealing therapeutic strategy against Epstein-Barr virus-associated malignancies.
25992613 miR-191 represses proliferation in primary human fibroblasts via targeting multiple proto-oncogenes, including CDK9, NOTCH2, and RPS6KA3.
25985737 C8orf4 negatively regulates the self-renewal of liver CSCs via suppression of NOTCH2 signalling
25957400 NOTCH2 inhibits PDGF-B-dependent proliferation and its expression is decreased by PDGF-B.
More...

AA Sequence

MPALRPALLWALLALWLCCAAPAHALQCRDGYEPCVNEGMCVTYHNGTGYCKCPEGFLGEYCQHRDPCEK      1 - 70
NRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSRPCLNGGTCHMLSRDTYECTCQVGFTGK     71 - 140
ECQWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKCETDVNECDIPGHCQHGGTCLNLPGSYQCQCP    141 - 210
QGFTGQYCDSLYVPCAPSPCVNGGTCRQTGDFTFECNCLPGFEGSTCERNIDDCPNHRCQNGGVCVDGVN    211 - 280
TYNCRCPPQWTGQFCTEDVDECLLQPNACQNGGTCANRNGGYGCVCVNGWSGDDCSENIDDCAFASCTPG    281 - 350
STCIDRVASFSCMCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGADCTEDVDECA    351 - 420
MANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCEMDINECHSDPCQNDATCLDKIGGFTCLCMPGFKGVH    421 - 490
CELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTPCLNGAKCIDHPNGYECQCAT    491 - 560
GFTGVLCEENIDNCDPDPCHHGQCQDGIDSYTCICNPGYMGAICSDQIDECYSSPCLNDGRCIDLVNGYQ    561 - 630
CNCQPGTSGVNCEINFDDCASNPCIHGICMDGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCING    631 - 700
VNGFRCICPEGPHHPSCYSQVNECLSNPCIHGNCTGGLSGYKCLCDAGWVGINCEVDKNECLSNPCQNGG    701 - 770
TCDNLVNGYRCTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDISGYTCHCVLPYTGKNCQTVLAPCSPN    771 - 840
PCENAAVCKESPNFESYTCLCAPGWQGQRCTIDIDECISKPCMNHGLCHNTQGSYMCECPPGFSGMDCEE    841 - 910
DIDDCLANPCQNGGSCMDGVNTFSCLCLPGFTGDKCQTDMNECLSEPCKNGGTCSDYVNSYTCKCQAGFD    911 - 980
GVHCENNINECTESSCFNGGTCVDGINSFSCLCPVGFTGSFCLHEINECSSHPCLNEGTCVDGLGTYRCS    981 - 1050
CPLGYTGKNCQTLVNLCSRSPCKNKGTCVQKKAESQCLCPSGWAGAYCDVPNVSCDIAASRRGVLVEHLC   1051 - 1120
QHSGVCINAGNTHYCQCPLGYTGSYCEEQLDECASNPCQHGATCSDFIGGYRCECVPGYQGVNCEYEVDE   1121 - 1190
CQNQPCQNGGTCIDLVNHFKCSCPPGTRGLLCEENIDDCARGPHCLNGGQCMDRIGGYSCRCLPGFAGER   1191 - 1260
CEGDINECLSNPCSSEGSLDCIQLTNDYLCVCRSAFTGRHCETFVDVCPQMPCLNGGTCAVASNMPDGFI   1261 - 1330
CRCPPGFSGARCQSSCGQVKCRKGEQCVHTASGPRCFCPSPRDCESGCASSPCQHGGSCHPQRQPPYYSC   1331 - 1400
QCAPPFSGSRCELYTAPPSTPPATCLSQYCADKARDGVCDEACNSHACQWDGGDCSLTMENPWANCSSPL   1401 - 1470
PCWDYINNQCDELCNTVECLFDNFECQGNSKTCKYDKYCADHFKDNHCDQGCNSEECGWDGLDCAADQPE   1471 - 1540
NLAEGTLVIVVLMPPEQLLQDARSFLRALGTLLHTNLRIKRDSQGELMVYPYYGEKSAAMKKQRMTRRSL   1541 - 1610
PGEQEQEVAGSKVFLEIDNRQCVQDSDHCFKNTDAAAALLASHAIQGTLSYPLVSVVSESLTPERTQLLY   1611 - 1680
LLAVAVVIILFIILLGVIMAKRKRKHGSLWLPEGFTLRRDASNHKRREPVGQDAVGLKNLSVQVSEANLI   1681 - 1750
GTGTSEHWVDDEGPQPKKVKAEDEALLSEEDDPIDRRPWTQQHLEAADIRRTPSLALTPPQAEQEVDVLD   1751 - 1820
VNVRGPDGCTPLMLASLRGGSSDLSDEDEDAEDSSANIITDLVYQGASLQAQTDRTGEMALHLAARYSRA   1821 - 1890
DAAKRLLDAGADANAQDNMGRCPLHAAVAADAQGVFQILIRNRVTDLDARMNDGTTPLILAARLAVEGMV   1891 - 1960
AELINCQADVNAVDDHGKSALHWAAAVNNVEATLLLLKNGANRDMQDNKEETPLFLAAREGSYEAAKILL   1961 - 2030
DHFANRDITDHMDRLPRDVARDRMHHDIVRLLDEYNVTPSPPGTVLTSALSPVICGPNRSFLSLKHTPMG   2031 - 2100
KKSRRPSAKSTMPTSLPNLAKEAKDAKGSRRKKSLSEKVQLSESSVTLSPVDSLESPHTYVSDTTSSPMI   2101 - 2170
TSPGILQASPNPMLATAAPPAPVHAQHALSFSNLHEMQPLAHGASTVLPSVSQLLSHHHIVSPGSGSAGS   2171 - 2240
LSRLHPVPVPADWMNRMEVNETQYNEMFGMVLAPAEGTHPGIAPQSRPPEGKHITTPREPLPPIVTFQLI   2241 - 2310
PKGSIAQPAGAPQPQSTCPPAVAGPLPTMYQIPEMARLPSVAFPTAMMPQQDGQVAQTILPAYHPFPASV   2311 - 2380
GKYPTPPSQHSYASSNAAERTPSHSGHLQGEHPYLTPSPESPDQWSSSSPHSASDWSDVTTSPTPGGAGG   2381 - 2450
GQRGPGTHMSEPPHNNMQVYA                                                    2451 - 2471
//

Text Mined References (187)

PMID Year Title
26640406 2015 Effects of Notch2 and Notch3 on Cell Proliferation and Apoptosis of Trophoblast Cell Lines.
26427670 2016 Notch2 signaling contributes to cell growth, invasion, and migration in salivary adenoid cystic carcinoma.
26252838 2015 NOTCH2 signaling confers immature morphology and aggressiveness in human hepatocellular carcinoma cells.
26165719 2015 A functional polymorphism in the pre?miR?146a gene influences the prognosis of glioblastoma multiforme by interfering with the balance between Notch1 and Notch2.
26041884 2015 Notch signaling sustains the expression of Mcl-1 and the activity of eIF4E to promote cell survival in CLL.
26041881 2015 The reciprocal regulation loop of Notch2 pathway and miR-23b in controlling gastric carcinogenesis.
26018735 2015 Cross talk between EBV and telomerase: the role of TERT and NOTCH2 in the switch of latent/lytic cycle of the virus.
25992613 2015 MiR-191 Regulates Primary Human Fibroblast Proliferation and Directly Targets Multiple Oncogenes.
25985737 2015 C8orf4 negatively regulates self-renewal of liver cancer stem cells via suppression of NOTCH2 signalling.
25957400 2015 Differential Regulation of NOTCH2 and NOTCH3 Contribute to Their Unique Functions in Vascular Smooth Muscle Cells.
More...