Property Summary

NCBI Gene PubMed Count 89
PubMed Score 265.84
PubTator Score 260.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (27)

Disease log2 FC p
psoriasis 1.100 1.4e-03
astrocytic glioma -1.100 1.6e-02
Astrocytoma, Pilocytic -1.200 1.5e-05
atypical teratoid / rhabdoid tumor -1.200 1.3e-07
Barrett's esophagus 2.000 2.6e-02
Breast cancer -4.300 4.0e-20
breast carcinoma -1.400 2.8e-02
colon cancer 2.100 8.6e-04
cutaneous lupus erythematosus 1.800 1.4e-03
cystic fibrosis -4.354 2.6e-08
ependymoma -1.200 2.2e-02
glioblastoma -1.200 2.6e-05
group 4 medulloblastoma -1.300 3.2e-04
interstitial lung disease 2.400 4.2e-02
lung adenocarcinoma 1.600 5.7e-03
malignant mesothelioma 3.400 8.6e-08
medulloblastoma, large-cell -1.100 6.6e-03
non-small cell lung cancer 4.867 1.7e-14
oligodendroglioma -1.100 1.8e-02
osteosarcoma 1.488 8.7e-04
ovarian cancer 2.300 5.5e-05
pancreatic cancer 3.000 6.9e-06
primary pancreatic ductal adenocarcinoma 1.750 1.7e-02
primary Sjogren syndrome -1.300 4.9e-02
primitive neuroectodermal tumor -1.200 3.6e-03
spina bifida -1.687 3.6e-02
ulcerative colitis 1.300 1.7e-02

Gene RIF (59)

AA Sequence

MTTSIRQFTSSSSIKGSSGLGGGSSRTSCRLSGGLGAGSCRLGSAGGLGSTLGGSSYSSCYSFGSGGGYG      1 - 70
SSFGGVDGLLAGGEKATMQNLNDRLASYLDKVRALEEANTELEVKIRDWYQRQAPGPARDYSQYYRTIEE     71 - 140
LQNKILTATVDNANILLQIDNARLAADDFRTKFETEQALRLSVEADINGLRRVLDELTLARADLEMQIEN    141 - 210
LKEELAYLKKNHEEEMNALRGQVGGEINVEMDAAPGVDLSRILNEMRDQYEKMAEKNRKDAEDWFFSKTE    211 - 280
ELNREVATNSELVQSGKSEISELRRTMQALEIELQSQLSMKASLEGNLAETENRYCVQLSQIQGLIGSVE    281 - 350
EQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHLTQYKKEPVTTRQVRTIVEEVQDGKV    351 - 420
ISSREQVHQTTR                                                              421 - 432
//

Text Mined References (108)

PMID Year Title