Property Summary

NCBI Gene PubMed Count 77
Grant Count 26
R01 Count 15
Funding $2,346,096.59
PubMed Score 246.97
PubTator Score 260.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
interstitial lung disease 2.800 0.047
malignant mesothelioma 3.400 0.000
astrocytic glioma -1.100 0.016
ependymoma -1.200 0.022
oligodendroglioma -1.100 0.018
Barrett's esophagus 2.000 0.026
psoriasis 2.000 0.000
cutaneous lupus erythematosus 1.800 0.001
osteosarcoma 1.488 0.001
cystic fibrosis -4.354 0.000
atypical teratoid / rhabdoid tumor -1.300 0.000
glioblastoma -1.200 0.000
medulloblastoma, large-cell -1.300 0.003
primitive neuroectodermal tumor -1.400 0.000
primary pancreatic ductal adenocarcinoma 3.148 0.001
non-small cell lung cancer 4.867 0.000
colon cancer 2.100 0.001
pancreatic cancer 3.000 0.000
breast carcinoma -2.300 0.000
group 4 medulloblastoma -1.300 0.000
pilocytic astrocytoma -1.200 0.000
primary Sjogren syndrome -1.400 0.050
lung adenocarcinoma 1.600 0.006
Breast cancer -4.300 0.000
spina bifida -1.687 0.036
ulcerative colitis 1.300 0.017
ovarian cancer 2.300 0.000

Gene RIF (48)

PMID Text
26740287 Cytokeratin 17 immunoexpression might have a role in evaluating surgical borders in some cases of actinic keratosis and Bowen disease.
26191283 These findings suggest that CK17 is involved in the development and metastasis of papillary thyroid carcinoma
26168014 Data indicate that autoimmune regulator Aire mRNA transcripts are regulated in a keratin 17 (K17) dependent manner in skin tumor keratinocytes.
26165312 Steatocystoma multiplex is associated with the R94C mutation in the KRTl7 gene, and is reported in a Chinese pedigree.
26109559 our findings establish that K17 functions specially among keratins as an oncoprotein by controlling the ability of p27(KIP1) to influence cervical cancer pathogenesis.
25736868 We conclude that K17 expression promotes oral squamous cell carcinoma cell growth and cell size but does not affect cell migration
25713416 These findings functionally integrate K17, hnRNP K, and gene expression along with RSK and CXCR3 signaling in a keratinocyte-autonomous axis and provide a potential basis for their implication in tumorigenesis
25111597 Case Report: polycystic kidney disease with steatocystoma multiplex. PKD1 mutations disrupt keratin 17 polymerization.
24471966 keratin14 expression can be used to detect early epithelial dysplasia, and that keratin13 and keratin17 expression are useful for detecting neoplastic changes
24335642 Peripheral or diffuse staining for CK17 is a useful marker of invasion in anal squamous neoplastic lesions.
More...

AA Sequence

MTTSIRQFTSSSSIKGSSGLGGGSSRTSCRLSGGLGAGSCRLGSAGGLGSTLGGSSYSSCYSFGSGGGYG      1 - 70
SSFGGVDGLLAGGEKATMQNLNDRLASYLDKVRALEEANTELEVKIRDWYQRQAPGPARDYSQYYRTIEE     71 - 140
LQNKILTATVDNANILLQIDNARLAADDFRTKFETEQALRLSVEADINGLRRVLDELTLARADLEMQIEN    141 - 210
LKEELAYLKKNHEEEMNALRGQVGGEINVEMDAAPGVDLSRILNEMRDQYEKMAEKNRKDAEDWFFSKTE    211 - 280
ELNREVATNSELVQSGKSEISELRRTMQALEIELQSQLSMKASLEGNLAETENRYCVQLSQIQGLIGSVE    281 - 350
EQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHLTQYKKEPVTTRQVRTIVEEVQDGKV    351 - 420
ISSREQVHQTTR                                                              421 - 432
//

Text Mined References (95)

PMID Year Title
26740287 2016 Cytokeratin 17 immunoexpression in actinic keratosis (bowenoid and nonbowenoid) and in Bowen disease.
26191283 2015 Overexpression of cytokeratin 17 is associated with the development of papillary thyroid carcinoma and the presence of lymph node metastasis.
26168014 2015 Keratin-dependent regulation of Aire and gene expression in skin tumor keratinocytes.
26165312 2015 Steatocystoma multiplex is associated with the R94C mutation in the KRTl7 gene.
26109559 2015 Keratin-17 Promotes p27KIP1 Nuclear Export and Degradation and Offers Potential Prognostic Utility.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25736868 2015 Keratin 17 is co-expressed with 14-3-3 sigma in oral carcinoma in situ and squamous cell carcinoma and modulates cell proliferation and size but not cell migration.
25713416 2015 Regulation of C-X-C chemokine gene expression by keratin 17 and hnRNP K in skin tumor keratinocytes.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
More...