Property Summary

NCBI Gene PubMed Count 154
PubMed Score 1856.31
PubTator Score 897.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
ependymoma -2.500 0.040
astrocytoma -1.100 0.000
oligodendroglioma -1.300 0.000
group 4 medulloblastoma -2.300 0.003
medulloblastoma, large-cell -1.500 0.032
adrenocortical carcinoma 1.122 0.006
non-small cell lung cancer 1.418 0.000
active ulcerative colitis 4.508 0.011
pilocytic astrocytoma -1.300 0.027
subependymal giant cell astrocytoma -2.900 0.001
Breast cancer -2.200 0.000
Pick disease -1.600 0.019
progressive supranuclear palsy -2.100 0.010
Down syndrome 1.400 0.012
psoriasis 1.300 0.000

Synonym

Accession Q04609 A4UU12 A9CB79 B7Z312 B7Z343 D3DQS5 E9PDX8 O43748 Q16305 Q541A4 Q8TAY3 Q9NP15 Q9NYE2 Q9P1P8
Symbols PSM
FGCP
FOLH
GCP2
PSMA
mGCP
GCPII
NAALAD1
NAALAdase

Gene

PANTHER Protein Class (1)

PDB

1Z8L   2C6C   2C6G   2C6P   2CIJ   2JBJ   2JBK   2OOT   2OR4   2PVV   2PVW   2XEF   2XEG   2XEI   2XEJ   3BHX   3BI0   3BI1   3BXM   3D7D   3D7F   3D7G   3D7H   3IWW   3RBU   3SJE   3SJF   3SJG   3SJX   4JYW   4JZ0   4LQG   4MCP   4MCQ   4MCR   4MCS   4NGM   4NGN   4NGP   4NGQ   4NGR   4NGS   4NGT   4OC0   4OC1   4OC2   4OC3   4OC4   4OC5   4OME   4P44   4P45   4P4B   4P4D   4P4E   4P4F   4P4I   4P4J   4W9Y   4X3R   5D29   5ELY   5F09  

Gene RIF (129)

PMID Text
27358992 Data show that the expressed antibody could specifically bind to prostate-specific membrane antigen ( PSMA) positive cells.
26977010 MDM2 and PSMA may co-regulate the expression of certain MMPs and, thus, the functionality of cells in metastatic breast cancer.
26771706 prostate-specific membrane antigen is significantly overexpressed in adrenocortical carcinoma neovasculature when compared with normal and benign adrenal tumors
26723876 Ad5/35E1aPSESE4 is effective in marking PSA/PSMA-positive prostate cancer cells in patient blood to improve the efficacy of utilizing CTCs as a biomarker.
26471812 Results from genetic models highlight the importance of GCPII genetic variants as relatively novel risk factors for breast cancer and prostate cancer.
26438155 Systemic treatment with these radiation-sensitizing agents selectively enhanced the potency of external beam radiation therapy for established PSMA-positive tumors.
26212031 evaluated the relaxometric properties of these agents in solution, in prostate cancer cells, and in an in vivo experimental model to demonstrate the feasibility of PSMA-based MR molecular imaging
26125931 In vitro immunotherapy is described for anti-prostate cancer effects of cytotoxic T lymphocytes induction by recombinant adenovirus mediated PSMA/4-1BBL dendritic cells.
26079448 This study demonstrated that Overexpression and Nucleolar Localization gcp2 in glioblastoma.
26028103 The findings suggest that C1561T-GCPII variation may be associated with risk for adenomatous polyp, and vitamin C may modify risk by interacting with the variant gene, its expression product and/or folate substrates.
More...

AA Sequence

MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENI      1 - 70
KKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFN     71 - 140
TSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFR    141 - 210
GNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYR    211 - 280
RGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTN    281 - 350
EVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFAS    351 - 420
WDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEG    421 - 490
KSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYE    491 - 560
LVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFD    561 - 630
SLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKY    631 - 700
AGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA                        701 - 750
//

Text Mined References (163)

PMID Year Title
27358992 2016 [Domestication of suspension CHO cells and its application in the expression of anti-PSMA antibody].
26977010 2016 MDM2 and PSMA Play Inhibitory Roles in Metastatic Breast Cancer Cells Through Regulation of Matrix Metalloproteinases.
26771706 2016 Prostate-Specific Membrane Antigen Is a Potential Antiangiogenic Target in Adrenocortical Carcinoma.
26723876 2016 Ad5/35E1aPSESE4: A novel approach to marking circulating prostate tumor cells with a replication competent adenovirus controlled by PSA/PSMA transcription regulatory elements.
26471812 2015 Clinical utility of genetic variants of glutamate carboxypeptidase II in predicting breast cancer and prostate cancer risk.
26438155 2015 Systemic Administration and Targeted Radiosensitization via Chemically Synthetic Aptamer-siRNA Chimeras in Human Tumor Xenografts.
26212031 2015 Synthesis and Evaluation of Gd(III) -Based Magnetic Resonance Contrast Agents for Molecular Imaging of Prostate-Specific Membrane Antigen.
26125931 2015 Anti-prostate cancer effects of CTL cell induction in vitro by recombinant adenovirus mediated PSMA/4-1BBL dendritic cells: an immunotherapy study.
26079448 2015 Overexpression and Nucleolar Localization of ?-Tubulin Small Complex Proteins GCP2 and GCP3 in Glioblastoma.
26028103 2015 Genetic Variation in Glutamate Carboxypeptidase II and Interaction with Dietary Natural Vitamin C May Predict Risk for Adenomatous Polyp Occurrence.
More...