Property Summary

Ligand Count 191
NCBI Gene PubMed Count 161
PubMed Score 2218.97
PubTator Score 897.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
active ulcerative colitis 4.508 1.1e-02
adrenocortical carcinoma 1.122 6.0e-03
astrocytoma -1.100 9.8e-06
Astrocytoma, Pilocytic -1.400 2.6e-02
Breast cancer -2.200 3.4e-11
Down syndrome 1.400 1.2e-02
ependymoma -2.500 4.0e-02
group 4 medulloblastoma -2.300 2.6e-03
medulloblastoma, large-cell -1.500 3.2e-02
non-small cell lung cancer 1.418 3.3e-07
oligodendroglioma -1.300 6.8e-06
Pick disease -1.600 1.9e-02
progressive supranuclear palsy -2.100 1.0e-02
psoriasis 1.300 8.2e-46
subependymal giant cell astrocytoma -2.900 9.6e-04

Synonym

Accession Q04609 A4UU12 A9CB79 B7Z312 B7Z343 D3DQS5 E9PDX8 O43748 Q16305 Q541A4 Q8TAY3 Q9NP15 Q9NYE2 Q9P1P8
Symbols PSM
FGCP
FOLH
GCP2
PSMA
mGCP
GCPII
NAALAD1
NAALAdase

Gene

PANTHER Protein Class (3)

PDB

1Z8L   2C6C   2C6G   2C6P   2CIJ   2JBJ   2JBK   2OOT   2OR4   2PVV   2PVW   2XEF   2XEG   2XEI   2XEJ   3BHX   3BI0   3BI1   3BXM   3D7D   3D7F   3D7G   3D7H   3IWW   3RBU   3SJE   3SJF   3SJG   3SJX   4JYW   4JZ0   4LQG   4MCP   4MCQ   4MCR   4MCS   4NGM   4NGN   4NGP   4NGQ   4NGR   4NGS   4NGT   4OC0   4OC1   4OC2   4OC3   4OC4   4OC5   4OME   4P44   4P45   4P4B   4P4D   4P4E   4P4F   4P4I   4P4J   4W9Y   4X3R   5D29   5ELY   5F09  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (136)

AA Sequence

MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENI      1 - 70
KKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFN     71 - 140
TSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFR    141 - 210
GNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYR    211 - 280
RGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTN    281 - 350
EVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFAS    351 - 420
WDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEG    421 - 490
KSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYE    491 - 560
LVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFD    561 - 630
SLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKY    631 - 700
AGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA                        701 - 750
//

Text Mined References (170)

PMID Year Title