Property Summary

NCBI Gene PubMed Count 17
PubMed Score 6.54
PubTator Score 3.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.017 0.031
malignant mesothelioma 1.100 0.000
psoriasis -1.900 0.000
osteosarcoma -1.782 0.000
ovarian cancer 1.100 0.000

Synonym

Accession Q04323 Q9BV93 Q9BVV5
Symbols 2B28
SAKS1
UBXD10

Gene

Gene RIF (5)

PMID Text
25681446 UBXN1 is a negative regulator of NF-kappaB signaling.
23545497 UBXN1 is induced and recruited to MAVS after virus infection, serving as a brake to prevent excessive RLR signaling, most likely at a late stage of infection.
21135095 SAKS1 inhibits protein degradation mediated by p97 complexes in the cytosol with a component of the mechanism being the ability to shield polyubiquitin chains from ubiquitin-processing factors.
20351172 Data suggest that UBXN1 regulates the enzymatic function of BRCA1 in a manner that is dependent on its ubiquitination status.
15944415 Specific interaction of rat protein 2B28 with rat Homer2 may play a role in regulation of protein degradation by ubiquitin-proteasome systems and that this function may be specific to Homer2 proteins among Homer family proteins.

AA Sequence

MAELTALESLIEMGFPRGRAEKALALTGNQGIEAAMDWLMEHEDDPDVDEPLETPLGHILGREPTSSEQG      1 - 70
GLEGSGSAAGEGKPALSEEERQEQTKRMLELVAQKQREREEREEREALERERQRRRQGQELSAARQRLQE     71 - 140
DEMRRAAEERRREKAEELAARQRVREKIERDKAERAKKYGGSVGSQPPPVAPEPGPVPSSPSQEPPTKRE    141 - 210
YDQCRIQVRLPDGTSLTQTFRAREQLAAVRLYVELHRGEELGGGQDPVQLLSGFPRRAFSEADMERPLQE    211 - 280
LGLVPSAVLIVAKKCPS                                                         281 - 297
//

Text Mined References (25)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25681446 2015 Ubiquitin-associated domain-containing ubiquitin regulatory X (UBX) protein UBXN1 is a negative regulator of nuclear factor ?B (NF-?B) signaling.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23545497 2013 UBXN1 interferes with Rig-I-like receptor-mediated antiviral immune response by targeting MAVS.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
21135095 2011 The UBX protein SAKS1 negatively regulates endoplasmic reticulum-associated degradation and p97-dependent degradation.
20351172 2010 The UBXN1 protein associates with autoubiquitinated forms of the BRCA1 tumor suppressor and inhibits its enzymatic function.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...