Property Summary

NCBI Gene PubMed Count 20
PubMed Score 6.54
PubTator Score 3.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Disease Progression 136 0.0 0.0
Stomach Neoplasms 300 0.0 0.0
Disease Target Count P-value
malignant mesothelioma 3232 2.2e-05
psoriasis 6694 4.8e-05
ovarian cancer 8520 3.9e-04
osteosarcoma 7950 4.3e-04
Multiple myeloma 1332 3.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.100 2.2e-05
Multiple myeloma 1.017 3.1e-02
osteosarcoma -1.094 4.3e-04
ovarian cancer 1.100 3.9e-04
psoriasis -1.900 4.8e-05

Gene RIF (7)

AA Sequence

MAELTALESLIEMGFPRGRAEKALALTGNQGIEAAMDWLMEHEDDPDVDEPLETPLGHILGREPTSSEQG      1 - 70
GLEGSGSAAGEGKPALSEEERQEQTKRMLELVAQKQREREEREEREALERERQRRRQGQELSAARQRLQE     71 - 140
DEMRRAAEERRREKAEELAARQRVREKIERDKAERAKKYGGSVGSQPPPVAPEPGPVPSSPSQEPPTKRE    141 - 210
YDQCRIQVRLPDGTSLTQTFRAREQLAAVRLYVELHRGEELGGGQDPVQLLSGFPRRAFSEADMERPLQE    211 - 280
LGLVPSAVLIVAKKCPS                                                         281 - 297
//

Text Mined References (28)

PMID Year Title