Property Summary

NCBI Gene PubMed Count 936
Grant Count 396
R01 Count 253
Funding $32,172,553.48
PubMed Score 941.64
PubTator Score 2032.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
ependymoma 1.500 0.000
Multiple myeloma 1.244 0.000
oligodendroglioma 1.300 0.007
astrocytoma 1.900 0.000
glioblastoma 1.400 0.000
atypical teratoid / rhabdoid tumor 1.300 0.000
medulloblastoma 1.100 0.000
primitive neuroectodermal tumor 1.100 0.048
colon cancer -1.600 0.032
pediatric high grade glioma 1.200 0.000
ovarian cancer 1.400 0.000

Synonym

Accession Q04206 Q6GTV1 Q6SLK1
Symbols p65
NFKB3

Gene

PANTHER Protein Class (1)

PDB

1NFI   2O61   3QXY   3RC0   2LSP   2N22   3GUT   4KV1   4KV4  

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
438 screening 60 / 15 / 12202 Cellular assay for TNF alpha induced NFkappaB translocation
1023 confirmatory 6 / 0 / 0 Identification of Molecular Probes for Cellular assay for TNF alpha induced NFkappaB translocation

Gene RIF (826)

PMID Text
27055013 Dynorphin 1-17 and Its N-Terminal Biotransformation Fragments Modulate Lipopolysaccharide-Stimulated Nuclear Factor-kappa B Nuclear Translocation, Interleukin-1beta and Tumor Necrosis Factor-alpha
27051065 findings provide evidence for the asymmetric arginine dimethylation of RelA and unveil a unique mechanism controlling TNFalpha/NF-kappaB signaling.
26841509 It is shown that the use of these inhibitors decreased the phosphorylation of the RelA (p65) as a main marker activation of the transcription factor NF-kB.
26826124 T Cell Receptor-induced Nuclear Factor kappaB (NF-kappaB) Signaling and Transcriptional Activation Are Regulated by STIM1- and Orai1-mediated Calcium Entry.
26805735 The pathological tissues of Xuanwei lung-cancer patients express high level of NF-kappaB-p65, and iNOS.
26801246 canonical NF-kappaB signaling pathway is activated in gastric cancer at least by the inactivation of miR-508-3p.
26787927 Profilin overexpressing cells show low basal activity of IkappaBalpha kinase (IKK), high amounts of cytoplasmic inhibitory subunit of NF-kappaB (IkappaBalpha) and p65, and low nuclear NF-kappaB DNA binding activity.
26718331 Survivin overexpression activates NFkappaB p65, which is important in the acquisition and maintenance of the oncogenic characteristics of esophageal squamous cell carcinoma.
26689593 The cross-talk between SP1 and p65, and the positive feedback regulatory loop of PI3-K/Akt signaling by EP4 contribute to the overall responses of solamargine in this process
26678048 common DNA variants in RELA and NFKB1, associate with kidney function and chronic kidney disease in gene association studies, providing the first evidence that genetic variation in NFkappaB contributes to renal aging phenotypes
More...

AA Sequence

MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPG      1 - 70
TVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNP     71 - 140
FQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGD    141 - 210
EIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDREL    211 - 280
SEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYP    281 - 350
FTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQA    351 - 420
VAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTE    421 - 490
PMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS             491 - 551
//

Text Mined References (957)

PMID Year Title
27055013 2016 Dynorphin 1-17 and Its N-Terminal Biotransformation Fragments Modulate Lipopolysaccharide-Stimulated Nuclear Factor-kappa B Nuclear Translocation, Interleukin-1beta and Tumor Necrosis Factor-alpha in Differentiated THP-1 Cells.
27051065 2016 Asymmetric arginine dimethylation of RelA provides a repressive mark to modulate TNF?/NF-?B response.
26841509 [Inhibition of NF-kB Activation Decreases Resistance in Acute Myeloid Leukemia Cells to TRAIL-induced Apoptosis in Multicellular Aggregates].
26826124 2016 T Cell Receptor-induced Nuclear Factor ?B (NF-?B) Signaling and Transcriptional Activation Are Regulated by STIM1- and Orai1-mediated Calcium Entry.
26805735 2016 [Association of Inorganics Accumulation with the Activation of NF-?B Signaling Pathway and the iNOS Expression of Lung Tissue in Xuanwei Lung Cancer Patients].
26801246 2016 miR-508-3p concordantly silences NFKB1 and RELA to inactivate canonical NF-?B signaling in gastric carcinogenesis.
26787927 2016 Profilin-PTEN interaction suppresses NF-?B activation via inhibition of IKK phosphorylation.
26718331 2016 Survivin activates NF??B p65 via the IKK? promoter in esophageal squamous cell carcinoma.
26689593 2015 Inactivation of PI3-K/Akt and reduction of SP1 and p65 expression increase the effect of solamargine on suppressing EP4 expression in human lung cancer cells.
26678048 2015 The Inflammatory Transcription Factors NF?B, STAT1 and STAT3 Drive Age-Associated Transcriptional Changes in the Human Kidney.
More...