Property Summary

NCBI Gene PubMed Count 12
PubMed Score 11.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (10)

Disease log2 FC p
active Crohn's disease 1.176 1.7e-02
adrenocortical carcinoma 1.107 1.1e-02
breast carcinoma 1.100 1.0e-03
chronic lymphosyte leukemia 1.200 1.1e-03
glioblastoma 1.100 7.4e-06
group 3 medulloblastoma 1.400 7.3e-03
pediatric high grade glioma 1.100 6.2e-04
primary Sjogren syndrome 1.200 8.8e-03
sarcoidosis 1.200 1.8e-02
spina bifida -1.760 4.3e-02

Gene RIF (3)

AA Sequence

MGPLTFRDVKIEFSLEEWQCLDTAQRNLYRDVMLENYRNLVFLGIAVSKPDLITWLEQGKEPWNLKRHEM      1 - 70
VDKTPVMCSHFAQDVWPEHSIKDSFQKVILRTYGKYGHENLQLRKDHKSVDACKVYKGGYNGLNQCLTTT     71 - 140
DSKIFQCDKYVKVFHKFPNVNRNKIRHTGKKPFKCKNRGKSFCMLSQLTQHKKIHTREYSYKCEECGKAF    141 - 210
NWSSTLTKHKIIHTGEKPYKCEECGKAFNRSSNLTKHKIIHTGEKPYKCEECGKAFNRSSTLTKHKRIHT    211 - 280
EEKPYKCEECGKAFNQFSILNKHKRIHMEDKPYKCEECGKAFRVFSILKKHKIIHTGEKPYKCEECGKAF    281 - 350
NQFSNLTKHKIIHTGEKPYKCDECGKAFNQSSTLTKHKRIHTGEKPYKCEECGKAFKQSSTLTEHKIIHT    351 - 420
GEKPYKCEKCGKAFSWSSAFTKHKRNHMEDKPYKCEECGKAFSVFSTLTKHKIIHTREKPYKCEECGKAF    421 - 490
NQSSIFTKHKIIHTEGKSYKCEKCGNAFNQSSNLTARKIIYTGEKPYKYEECDKAFNKFSTLITHQIIYT    491 - 560
GEKPCKHECGRAFNKSSNYTKEKLQT                                                561 - 586
//

Text Mined References (13)

PMID Year Title