Property Summary

NCBI Gene PubMed Count 20
Grant Count 8
Funding $875,836.8
PubMed Score 51.91
PubTator Score 37.68

Knowledge Summary

Patent (1,785)

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma -1.100 0.000
osteosarcoma -2.144 0.000
posterior fossa group A ependymoma -1.600 0.000
glioblastoma -1.600 0.000
sonic hedgehog group medulloblastoma -1.800 0.000
adult high grade glioma -1.300 0.000
atypical teratoid/rhabdoid tumor -1.200 0.000
pilocytic astrocytoma -1.700 0.000
Breast cancer -1.200 0.000

Gene RIF (7)

PMID Text
25609640 These results suggest a novel peripheral mechanism of post-spinal cord injury pain sensitization implicating Kv3.4 channel dysregulation and potential Kv3.4-based therapeutic interventions.
23443853 Ionizing radiation-induced G2/M arrest was preceded by activation of Kv3.4-like voltage-gated potassium channels.
22473424 these data suggest that Kv3.4 and Cav1.2 may act together to control Ca(2) -dependent electrical activity of pioneer axons and play important roles during axon pathfinding.
21912965 Although all KV3 subunit transcripts are significantly expressed at embryonic age in whole mouse brain extracts, only KV3.1, KV3.2 and KV3.4 subunit transgenic proteins are present.
20093253 Kv3.4 channels exert a permissive role in the cell cycle progression of proliferating uterine vascular smooth cells.
16449802 The characterization of a missense mutation in MiRP2 that affects its phosphorylation and consequent interactions with Kv3.4 is reported.
15485486 Kv3.4 was overexpressed in early stages of Alzheimer disease and in advanced stages was present at high levels in neurodegenerative structures. This subunit regulates delayed-rectifier currents, primary determinants of spike repolarization in neurones

AA Sequence

MISSVCVSSYRGRKSGNKPPSKTCLKEEMAKGEASEKIIINVGGTRHETYRSTLRTLPGTRLAWLADPDG      1 - 70
GGRPETDGGGVGSSGSSGGGGCEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELTFWGIDETDV     71 - 140
EPCCWMTYRQHRDAEEALDIFESPDGGGSGAGPSDEAGDDERELALQRLGPHEGGAGHGAGSGGCRGWQP    141 - 210
RMWALFEDPYSSRAARVVAFASLFFILVSITTFCLETHEAFNIDRNVTEILRVGNITSVHFRREVETEPI    211 - 280
LTYIEGVCVLWFTLEFLVRIVCCPDTLDFVKNLLNIIDFVAILPFYLEVGLSGLSSKAARDVLGFLRVVR    281 - 350
FVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGARPSDPRGNDHTDF    351 - 420
KNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPK    421 - 490
KRKKHVPRPAQLESPMYCKSEETSPRDSTCSDTSPPAREEGMIERKRADSKQNGDANAVLSDEEGAGLTQ    491 - 560
PLASSPTPEERRALRRSTTRDRNKKAAACFLLSTGDYACADGSVRKGTFVLRDLPLQHSPEAACPPTAGT    561 - 630
LFLPH                                                                     631 - 635
//

Text Mined References (23)

PMID Year Title
25609640 2015 Dysregulation of Kv3.4 channels in dorsal root ganglia following spinal cord injury.
23443853 2013 Kv3.4 potassium channel-mediated electrosignaling controls cell cycle and survival of irradiated leukemia cells.
22473424 2012 Coexpression of high-voltage-activated ion channels Kv3.4 and Cav1.2 in pioneer axons during pathfinding in the developing rat forebrain.
21912965 2012 Brain expression of Kv3 subunits during development, adulthood and aging and in a murine model of Alzheimer's disease.
20707712 2010 A genome-wide association study of self-rated health.
20593490 2010 Expression and clinical significance of the Kv3.4 potassium channel subunit in the development and progression of head and neck squamous cell carcinomas.
20378681 2010 Kv3.4, a key signalling molecule controlling the cell cycle and proliferation of human arterial smooth muscle cells.
20093253 2010 Cell cycle-dependent expression of Kv3.4 channels modulates proliferation of human uterine artery smooth muscle cells.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16449802 2006 Phosphorylation and protonation of neighboring MiRP2 sites: function and pathophysiology of MiRP2-Kv3.4 potassium channels in periodic paralysis.
More...