Property Summary

NCBI Gene PubMed Count 54
PubMed Score 126.43
PubTator Score 115.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Metaphyseal chondrodysplasia Schmid type 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Macular degeneration 65 0.0 3.0
Disease Target Count Z-score Confidence
Age related macular degeneration 72 0.0 5.0

Expression

  Differential Expression (12)

Disease log2 FC p
Breast cancer 2.900 2.6e-02
breast carcinoma 2.600 3.4e-05
colon cancer 1.900 1.2e-02
ductal carcinoma in situ 4.100 1.3e-05
invasive ductal carcinoma 5.677 7.6e-08
lung adenocarcinoma 1.400 2.8e-08
nasopharyngeal carcinoma 1.200 8.5e-03
non-small cell lung cancer 3.648 1.3e-20
osteosarcoma 3.173 3.0e-02
ovarian cancer 3.000 3.3e-03
pancreatic cancer 3.000 1.5e-05
primary pancreatic ductal adenocarcinoma 3.431 5.0e-04

 GO Function (1)

Protein-protein Interaction (8)

Gene RIF (27)

AA Sequence

MLPQIPFLLLVSLNLVHGVFYAERYQMPTGIKGPLPNTKTQFFIPYTIKSKGIAVRGEQGTPGPPGPAGP      1 - 70
RGHPGPSGPPGKPGYGSPGLQGEPGLPGPPGPSAVGKPGVPGLPGKPGERGPYGPKGDVGPAGLPGPRGP     71 - 140
PGPPGIPGPAGISVPGKPGQQGPTGAPGPRGFPGEKGAPGVPGMNGQKGEMGYGAPGRPGERGLPGPQGP    141 - 210
TGPSGPPGVGKRGENGVPGQPGIKGDRGFPGEMGPIGPPGPQGPPGERGPEGIGKPGAAGAPGQPGIPGT    211 - 280
KGLPGAPGIAGPPGPPGFGKPGLPGLKGERGPAGLPGGPGAKGEQGPAGLPGKPGLTGPPGNMGPQGPKG    281 - 350
IPGSHGLPGPKGETGPAGPAGYPGAKGERGSPGSDGKPGYPGKPGLDGPKGNPGLPGPKGDPGVGGPPGL    351 - 420
PGPVGPAGAKGMPGHNGEAGPRGAPGIPGTRGPIGPPGIPGFPGSKGDPGSPGPPGPAGIATKGLNGPTG    421 - 490
PPGPPGPRGHSGEPGLPGPPGPPGPPGQAVMPEGFIKAGQRPSLSGTPLVSANQGVTGMPVSAFTVILSK    491 - 560
AYPAIGTPIPFDKILYNRQQHYDPRTGIFTCQIPGIYYFSYHVHVKGTHVWVGLYKNGTPVMYTYDEYTK    561 - 630
GYLDQASGSAIIDLTENDQVWLQLPNAESNGLYSSEYVHSSFSGFLVAPM                        631 - 680
//

Text Mined References (56)

PMID Year Title