Property Summary

NCBI Gene PubMed Count 184
PubMed Score 0.00
PubTator Score 295.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (21)

Disease log2 FC p
active Crohn's disease 1.667 2.3e-02
active ulcerative colitis 1.729 1.2e-02
Astrocytoma, Pilocytic 1.300 2.2e-04
colon cancer 1.700 4.8e-02
cutaneous lupus erythematosus 1.400 4.6e-04
Endometriosis -1.330 3.0e-02
glioblastoma 1.300 5.1e-03
group 4 medulloblastoma -1.200 5.5e-04
head and neck cancer and chronic obstruc... 1.100 4.8e-02
interstitial cystitis 1.500 1.0e-03
juvenile dermatomyositis 2.577 9.5e-19
lung cancer -2.500 1.9e-03
malignant mesothelioma 1.800 9.1e-07
medulloblastoma, large-cell -1.600 4.8e-04
osteosarcoma 1.007 1.2e-02
ovarian cancer 1.200 9.0e-03
pancreatic cancer 1.300 1.3e-02
primary pancreatic ductal adenocarcinoma 1.461 4.1e-03
primary Sjogren syndrome 2.200 3.1e-05
psoriasis 1.600 3.0e-07
tuberculosis 1.400 3.6e-04

Protein-protein Interaction (1)

Gene RIF (154)

AA Sequence

MRLPDLRPWTSLLLVDAALLWLLQGPLGTLLPQGLPGLWLEGTLRLGGLWGLLKLRGLLGFVGTLLLPLC      1 - 70
LATPLTVSLRALVAGASRAPPARVASAPWSWLLVGYGAAGLSWSLWAVLSPPGAQEKEQDQVNNKVLMWR     71 - 140
LLKLSRPDLPLLVAAFFFLVLAVLGETLIPHYSGRVIDILGGDFDPHAFASAIFFMCLFSFGSSLSAGCR    141 - 210
GGCFTYTMSRINLRIREQLFSSLLRQDLGFFQETKTGELNSRLSSDTTLMSNWLPLNANVLLRSLVKVVG    211 - 280
LYGFMLSISPRLTLLSLLHMPFTIAAEKVYNTRHQEVLREIQDAVARAGQVVREAVGGLQTVRSFGAEEH    281 - 350
EVCRYKEALEQCRQLYWRRDLERALYLLVRRVLHLGVQMLMLSCGLQQMQDGELTQGSLLSFMIYQESVG    351 - 420
SYVQTLVYIYGDMLSNVGAAEKVFSYMDRQPNLPSPGTLAPTTLQGVVKFQDVSFAYPNRPDRPVLKGLT    421 - 490
FTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQVLLDEKPISQYEHCYLHSQVVSVGQEPVLFSGSV    491 - 560
RNNIAYGLQSCEDDKVMAAAQAAHADDFIQEMEHGIYTDVGEKGSQLAAGQKQRLAIARALVRDPRVLIL    561 - 630
DEATSALDVQCEQALQDWNSRGDRTVLVIAHRLQTVQRAHQILVLQEGKLQKLAQL                  631 - 686
//

Text Mined References (187)

PMID Year Title