Property Summary

NCBI Gene PubMed Count 177
Grant Count 31
R01 Count 23
Funding $2,736,319.35
PubMed Score 0.00
PubTator Score 295.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
malignant mesothelioma 1.800 0.000
psoriasis 1.600 0.000
cutaneous lupus erythematosus 1.900 0.000
osteosarcoma 1.007 0.012
group 4 medulloblastoma -1.200 0.001
glioblastoma 1.300 0.005
medulloblastoma, large-cell -1.600 0.000
juvenile dermatomyositis 2.577 0.000
primary pancreatic ductal adenocarcinoma 1.461 0.004
tuberculosis 1.400 0.000
colon cancer 1.700 0.048
lung cancer -2.500 0.002
active Crohn's disease 2.197 0.002
ulcerative colitis 2.100 0.000
interstitial cystitis 1.900 0.008
pilocytic astrocytoma 1.300 0.000
primary Sjogren syndrome 2.200 0.000
Endometriosis -1.330 0.030
ovarian cancer 1.200 0.009
pancreatic cancer 1.300 0.013
head and neck cancer and chronic obstruc... 1.100 0.048

Gene RIF (146)

PMID Text
26789246 cryo-electron microscopy structure of human TAP in complex with its inhibitor ICP47, a small protein produced by the herpes simplex virus I
26519531 TAP/TPN complex formation is driven by hydrophobic interactions via leucine zipper-like motifs.
25874709 TAP2, HLA-DOA, HLA-DOB, and tapasin loci are novel candidate regions for susceptibility to HCV infection and viral clearance in the Chinese population
25846714 We showed that TAP2 gene has an association with pulmonary tuberculosis in Koreans.
24972609 Our meta-analyses suggested that TAP2-379Ile allele was significantly associated with a 59% increased risk for rheumatoid arthritis
24923865 Studies indicate that ABC transporters associated with antigen processing TAP1/2 (ABCB2/3) is a crucial element of the adaptive immune system.
24501197 Three tapasin binding sites on TAP have been described, two of which are located in the N-terminal domains of TAP1 and TAP2.
24288424 TAP1 AND TAP2 polymorphisms are associated with a reduced risk for developing cervical intraepithelial neoplasia.
24196954 TAP1-TAP2 NBD dimers are not fully stabilized by nucleotides alone, and substrate binding plays a key role in inducing the transition state conformations of the NBD.
24175803 Results suggested an association between TAP2-565 polymorphism and chronic lymphoid leukemia (CLL). TAP2-665 GG genotype might be a risk factor for CLL, chronic myeloblastic leukemia, and multiple myeloma.
More...

AA Sequence

MRLPDLRPWTSLLLVDAALLWLLQGPLGTLLPQGLPGLWLEGTLRLGGLWGLLKLRGLLGFVGTLLLPLC      1 - 70
LATPLTVSLRALVAGASRAPPARVASAPWSWLLVGYGAAGLSWSLWAVLSPPGAQEKEQDQVNNKVLMWR     71 - 140
LLKLSRPDLPLLVAAFFFLVLAVLGETLIPHYSGRVIDILGGDFDPHAFASAIFFMCLFSFGSSLSAGCR    141 - 210
GGCFTYTMSRINLRIREQLFSSLLRQDLGFFQETKTGELNSRLSSDTTLMSNWLPLNANVLLRSLVKVVG    211 - 280
LYGFMLSISPRLTLLSLLHMPFTIAAEKVYNTRHQEVLREIQDAVARAGQVVREAVGGLQTVRSFGAEEH    281 - 350
EVCRYKEALEQCRQLYWRRDLERALYLLVRRVLHLGVQMLMLSCGLQQMQDGELTQGSLLSFMIYQESVG    351 - 420
SYVQTLVYIYGDMLSNVGAAEKVFSYMDRQPNLPSPGTLAPTTLQGVVKFQDVSFAYPNRPDRPVLKGLT    421 - 490
FTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQVLLDEKPISQYEHCYLHSQVVSVGQEPVLFSGSV    491 - 560
RNNIAYGLQSCEDDKVMAAAQAAHADDFIQEMEHGIYTDVGEKGSQLAAGQKQRLAIARALVRDPRVLIL    561 - 630
DEATSALDVQCEQALQDWNSRGDRTVLVIAHRLQTVQRAHQILVLQEGKLQKLAQL                  631 - 686
//

Text Mined References (180)

PMID Year Title
26789246 2016 A mechanism of viral immune evasion revealed by cryo-EM analysis of the TAP transporter.
26519531 2015 Hydrophobic Interactions Are Key To Drive the Association of Tapasin with Peptide Transporter Subunit TAP2.
25874709 2015 Association of polymorphisms in HLA antigen presentation-related genes with the outcomes of HCV infection.
25846714 2015 Association of TAP1 and TAP2 genes with susceptibility to pulmonary tuberculosis in Koreans.
24972609 2014 Significant association between TAP2 polymorphisms and rheumatoid arthritis: a meta-analysis.
24923865 2015 ABC transporters in adaptive immunity.
24501197 2014 Three tapasin docking sites in TAP cooperate to facilitate transporter stabilization and heterodimerization.
24288424 2013 Association of TAP gene polymorphisms and risk of cervical intraepithelial neoplasia.
24196954 2013 Analyses of conformational states of the transporter associated with antigen processing (TAP) protein in a native cellular membrane environment.
24175803 2013 Association of TAP1 and TAP2 gene polymorphisms with hematological malignancies.
More...