Property Summary

NCBI Gene PubMed Count 228
PubMed Score 69.15
PubTator Score 509.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Bare Lymphocyte Syndrome, Type I 4 0.0 0.0
Myocardial Ischemia 169 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
MHC class I deficiency 5 4.109 2.1
Disease Target Count
Bare lymphocyte syndrome type 1 4

Expression

  Differential Expression (29)

Disease log2 FC p
active Crohn's disease 1.859 1.4e-03
active ulcerative colitis 1.466 1.1e-02
astrocytoma 1.200 5.9e-14
Astrocytoma, Pilocytic 1.400 1.8e-06
Breast cancer 1.400 1.3e-05
breast carcinoma 1.100 2.1e-19
cutaneous lupus erythematosus 1.400 1.0e-03
dermatomyositis 1.800 1.2e-02
esophageal adenocarcinoma 1.300 3.1e-02
glioblastoma 1.100 9.9e-04
group 4 medulloblastoma -1.100 1.3e-02
interstitial cystitis 1.800 3.0e-03
intraductal papillary-mucinous carcinoma... 1.300 8.8e-03
intraductal papillary-mucinous neoplasm ... 1.400 8.7e-03
invasive ductal carcinoma 1.400 3.1e-03
juvenile dermatomyositis 2.681 1.8e-16
lung cancer -1.300 7.9e-03
lung carcinoma -2.100 6.4e-18
medulloblastoma, large-cell -1.800 8.6e-04
Multiple Sclerosis 1.100 4.7e-03
oligodendroglioma 1.100 4.0e-11
ovarian cancer 1.700 1.3e-04
pancreatic ductal adenocarcinoma liver m... 1.727 2.1e-02
pituitary cancer -1.600 1.0e-03
posterior fossa group A ependymoma 1.300 6.5e-06
primary Sjogren syndrome 1.600 7.2e-03
psoriasis 1.300 9.2e-04
sarcoidosis 1.300 1.3e-02
subependymal giant cell astrocytoma 1.782 2.6e-03

Protein-protein Interaction (1)

Gene RIF (206)

AA Sequence

MAELLASAGSACSWDFPRAPPSFPPPAASRGGLGGTRSFRPHRGAESPRPGRDRDGVRVPMASSRCPAPR      1 - 70
GCRCLPGASLAWLGTVLLLLADWVLLRTALPRIFSLLVPTALPLLRVWAVGLSRWAVLWLGACGVLRATV     71 - 140
GSKSENAGAQGWLAALKPLAAALGLALPGLALFRELISWGAPGSADSTRLLHWGSHPTAFVVSYAAALPA    141 - 210
AALWHKLGSLWVPGGQGGSGNPVRRLLGCLGSETRRLSLFLVLVVLSSLGEMAIPFFTGRLTDWILQDGS    211 - 280
ADTFTRNLTLMSILTIASAVLEFVGDGIYNNTMGHVHSHLQGEVFGAVLRQETEFFQQNQTGNIMSRVTE    281 - 350
DTSTLSDSLSENLSLFLWYLVRGLCLLGIMLWGSVSLTMVTLITLPLLFLLPKKVGKWYQLLEVQVRESL    351 - 420
AKSSQVAIEALSAMPTVRSFANEEGEAQKFREKLQEIKTLNQKEAVAYAVNSWTTSISGMLLKVGILYIG    421 - 490
GQLVTSGAVSSGNLVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGLLTPLHLE    491 - 560
GLVQFQDVSFAYPNRPDVLVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPLP    561 - 630
QYEHRYLHRQVAAVGQEPQVFGRSLQENIAYGLTQKPTMEEITAAAVKSGAHSFISGLPQGYDTEVDEAG    631 - 700
SQLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPERYSRSVLLITQHLSLVEQAD    701 - 770
HILFLEGGAIREGGTHQQLMEKKGCYWAMVQAPADAPE                                    771 - 808
//

Text Mined References (233)

PMID Year Title