Tbio | Antigen peptide transporter 1 |
Involved in the transport of antigens from the cytoplasm to the endoplasmic reticulum for association with MHC class I molecules. Also acts as a molecular scaffold for the final stage of MHC class I folding, namely the binding of peptide. Nascent MHC class I molecules associate with TAP via tapasin. Inhibited by the covalent attachment of herpes simplex virus ICP47 protein, which blocks the peptide-binding site of TAP. Inhibited by human cytomegalovirus US6 glycoprotein, which binds to the lumenal side of the TAP complex and inhibits peptide translocation by specifically blocking ATP-binding to TAP1 and prevents the conformational rearrangement of TAP induced by peptide binding. Inhibited by human adenovirus E3-19K glycoprotein, which binds the TAP complex and acts as a tapasin inhibitor, preventing MHC class I/TAP association. Expression of TAP1 is down-regulated by human Epstein-Barr virus vIL-10 protein, thereby affecting the transport of peptides into the endoplasmic reticulum and subsequent peptide loading by MHC class I molecules.
The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is involved in the pumping of degraded cytosolic peptides across the endoplasmic reticulum into the membrane-bound compartment where class I molecules assemble. Mutations in this gene may be associated with ankylosing spondylitis, insulin-dependent diabetes mellitus, and celiac disease. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2014]
The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is involved in the pumping of degraded cytosolic peptides across the endoplasmic reticulum into the membrane-bound compartment where class I molecules assemble. Mutations in this gene may be associated with ankylosing spondylitis, insulin-dependent diabetes mellitus, and celiac disease. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2014]
Comments
Disease | Target Count |
---|---|
Bare Lymphocyte Syndrome, Type I | 4 |
Myocardial Ischemia | 169 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
MHC class I deficiency | 3 | 4.093 | 2.0 |
Partial central choroid dystrophy | 12 | 3.886 | 1.9 |
Branchiootorenal syndrome | 9 | 3.045 | 1.5 |
Disease | Target Count |
---|---|
Bare lymphocyte syndrome type 1 | 4 |
Disease | Target Count |
---|---|
Bare lymphocyte syndrome 1 | 3 |
Species | Source |
---|---|
Mouse | OMA Inparanoid |
Rat | OMA Inparanoid |
Dog | OMA Inparanoid |
Horse | OMA Inparanoid |
Cow | OMA Inparanoid |
Pig | OMA Inparanoid |
Opossum | OMA Inparanoid |
Xenopus | OMA Inparanoid |
Zebrafish | OMA Inparanoid |
PMID | Text |
---|---|
26789246 | cryo-electron microscopy structure of human TAP in complex with its inhibitor ICP47, a small protein produced by the herpes simplex virus I |
26782532 | The results suggest an association between a TAP1 promoter SNP (rs2071480) and susceptibility to alopecia areata in a Korean population. |
26735690 | IFNalpha upregulates TAP1 expression in peripheral blood mononuclear cells (PBMCs) of patients with malignant melanoma receiving adjuvant high-dose immunotherapy. |
25846714 | None of TAP1 alleles showed a signi fi cant di ff erence in phenotype frequency between pulmonary tuberculosis and controls, and among subgroups of pulmonary tuberculosis. |
25656091 | this ultrasensitive method for the first time permits quantification of TAP activity under close to physiological conditions in scarce primary cell subsets such as antigen cross-presenting dendritic cells. |
25548428 | The TAP1-rs1135216 and PSMB9-rs17587 variants are significantly associated with vitiligo, and even one copy of these mutant alleles can influence the risk among Saudis. |
25403418 | PSF1 is expressed in high-grade prostate cancer and may be a useful biomarker to identify patients with a poor prognosis at the time of diagnosis |
25398693 | PSF1 was overexpressed in lung cancer. |
25198552 | PSF1 expression correlates with a more aggressive phenotype as well as worse prognosis in hepatocellular carcinoma patients. |
24923865 | Studies indicate that ABC transporters associated with antigen processing TAP1/2 (ABCB2/3) is a crucial element of the adaptive immune system. |
More... |
MAELLASAGSACSWDFPRAPPSFPPPAASRGGLGGTRSFRPHRGAESPRPGRDRDGVRVPMASSRCPAPR 1 - 70 GCRCLPGASLAWLGTVLLLLADWVLLRTALPRIFSLLVPTALPLLRVWAVGLSRWAVLWLGACGVLRATV 71 - 140 GSKSENAGAQGWLAALKPLAAALGLALPGLALFRELISWGAPGSADSTRLLHWGSHPTAFVVSYAAALPA 141 - 210 AALWHKLGSLWVPGGQGGSGNPVRRLLGCLGSETRRLSLFLVLVVLSSLGEMAIPFFTGRLTDWILQDGS 211 - 280 ADTFTRNLTLMSILTIASAVLEFVGDGIYNNTMGHVHSHLQGEVFGAVLRQETEFFQQNQTGNIMSRVTE 281 - 350 DTSTLSDSLSENLSLFLWYLVRGLCLLGIMLWGSVSLTMVTLITLPLLFLLPKKVGKWYQLLEVQVRESL 351 - 420 AKSSQVAIEALSAMPTVRSFANEEGEAQKFREKLQEIKTLNQKEAVAYAVNSWTTSISGMLLKVGILYIG 421 - 490 GQLVTSGAVSSGNLVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGLLTPLHLE 491 - 560 GLVQFQDVSFAYPNRPDVLVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPLP 561 - 630 QYEHRYLHRQVAAVGQEPQVFGRSLQENIAYGLTQKPTMEEITAAAVKSGAHSFISGLPQGYDTEVDEAG 631 - 700 SQLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPERYSRSVLLITQHLSLVEQAD 701 - 770 HILFLEGGAIREGGTHQQLMEKKGCYWAMVQAPADAPE 771 - 808 //
PMID | Year | Title |
---|---|---|
26871637 | 2016 | Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing. |
26789246 | 2016 | A mechanism of viral immune evasion revealed by cryo-EM analysis of the TAP transporter. |
26782532 | 2015 | Association between TAP1 gene polymorphisms and alopecia areata in a Korean population. |
26735690 | 2016 | Interferon Alpha Signalling and Its Relevance for the Upregulatory Effect of Transporter Proteins Associated with Antigen Processing (TAP) in Patients with Malignant Melanoma. |
25944712 | 2015 | N-terminome analysis of the human mitochondrial proteome. |
25846714 | 2015 | Association of TAP1 and TAP2 genes with susceptibility to pulmonary tuberculosis in Koreans. |
25656091 | 2015 | Ultrasensitive quantification of TAP-dependent antigen compartmentalization in scarce primary immune cell subsets. |
25548428 | 2014 | Transporter TAP1-637G and immunoproteasome PSMB9-60H variants influence the risk of developing vitiligo in the Saudi population. |
25403418 | 2015 | Evaluation of PSF1 as a prognostic biomarker for prostate cancer. |
25398693 | 2015 | Knockdown of PSF1 expression inhibits cell proliferation in lung cancer cells in vitro. |
More... |