Property Summary

NCBI Gene PubMed Count 219
Grant Count 94
R01 Count 56
Funding $10,982,595.13
PubMed Score 63.52
PubTator Score 509.55

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q03518 Q16149 Q96CP4 APT1
Symbols APT1
PSF1
ABC17
ABCB2
PSF-1
RING4
TAP1N
D6S114E
TAP1*0102N

Gene

PDB

1JJ7  

Gene RIF (197)

PMID Text
26789246 cryo-electron microscopy structure of human TAP in complex with its inhibitor ICP47, a small protein produced by the herpes simplex virus I
26782532 The results suggest an association between a TAP1 promoter SNP (rs2071480) and susceptibility to alopecia areata in a Korean population.
26735690 IFNalpha upregulates TAP1 expression in peripheral blood mononuclear cells (PBMCs) of patients with malignant melanoma receiving adjuvant high-dose immunotherapy.
25846714 None of TAP1 alleles showed a signi fi cant di ff erence in phenotype frequency between pulmonary tuberculosis and controls, and among subgroups of pulmonary tuberculosis.
25656091 this ultrasensitive method for the first time permits quantification of TAP activity under close to physiological conditions in scarce primary cell subsets such as antigen cross-presenting dendritic cells.
25548428 The TAP1-rs1135216 and PSMB9-rs17587 variants are significantly associated with vitiligo, and even one copy of these mutant alleles can influence the risk among Saudis.
25403418 PSF1 is expressed in high-grade prostate cancer and may be a useful biomarker to identify patients with a poor prognosis at the time of diagnosis
25398693 PSF1 was overexpressed in lung cancer.
25198552 PSF1 expression correlates with a more aggressive phenotype as well as worse prognosis in hepatocellular carcinoma patients.
24923865 Studies indicate that ABC transporters associated with antigen processing TAP1/2 (ABCB2/3) is a crucial element of the adaptive immune system.
More...

AA Sequence

MAELLASAGSACSWDFPRAPPSFPPPAASRGGLGGTRSFRPHRGAESPRPGRDRDGVRVPMASSRCPAPR      1 - 70
GCRCLPGASLAWLGTVLLLLADWVLLRTALPRIFSLLVPTALPLLRVWAVGLSRWAVLWLGACGVLRATV     71 - 140
GSKSENAGAQGWLAALKPLAAALGLALPGLALFRELISWGAPGSADSTRLLHWGSHPTAFVVSYAAALPA    141 - 210
AALWHKLGSLWVPGGQGGSGNPVRRLLGCLGSETRRLSLFLVLVVLSSLGEMAIPFFTGRLTDWILQDGS    211 - 280
ADTFTRNLTLMSILTIASAVLEFVGDGIYNNTMGHVHSHLQGEVFGAVLRQETEFFQQNQTGNIMSRVTE    281 - 350
DTSTLSDSLSENLSLFLWYLVRGLCLLGIMLWGSVSLTMVTLITLPLLFLLPKKVGKWYQLLEVQVRESL    351 - 420
AKSSQVAIEALSAMPTVRSFANEEGEAQKFREKLQEIKTLNQKEAVAYAVNSWTTSISGMLLKVGILYIG    421 - 490
GQLVTSGAVSSGNLVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGLLTPLHLE    491 - 560
GLVQFQDVSFAYPNRPDVLVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPLP    561 - 630
QYEHRYLHRQVAAVGQEPQVFGRSLQENIAYGLTQKPTMEEITAAAVKSGAHSFISGLPQGYDTEVDEAG    631 - 700
SQLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPERYSRSVLLITQHLSLVEQAD    701 - 770
HILFLEGGAIREGGTHQQLMEKKGCYWAMVQAPADAPE                                    771 - 808
//

Text Mined References (224)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26789246 2016 A mechanism of viral immune evasion revealed by cryo-EM analysis of the TAP transporter.
26782532 2015 Association between TAP1 gene polymorphisms and alopecia areata in a Korean population.
26735690 2016 Interferon Alpha Signalling and Its Relevance for the Upregulatory Effect of Transporter Proteins Associated with Antigen Processing (TAP) in Patients with Malignant Melanoma.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25846714 2015 Association of TAP1 and TAP2 genes with susceptibility to pulmonary tuberculosis in Koreans.
25656091 2015 Ultrasensitive quantification of TAP-dependent antigen compartmentalization in scarce primary immune cell subsets.
25548428 2014 Transporter TAP1-637G and immunoproteasome PSMB9-60H variants influence the risk of developing vitiligo in the Saudi population.
25403418 2015 Evaluation of PSF1 as a prognostic biomarker for prostate cancer.
25398693 2015 Knockdown of PSF1 expression inhibits cell proliferation in lung cancer cells in vitro.
More...