Property Summary

NCBI Gene PubMed Count 65
Grant Count 108
R01 Count 78
Funding $14,742,684.49
PubMed Score 227.24
PubTator Score 139.70

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q03403 Q15854
Symbols SP
SML1

Gene

PANTHER Protein Class (2)

Gene RIF (45)

PMID Text
26240479 These findings suggest that the rs184432 and rs225359 polymorphisms in TFF1 have protective effects for GC and contribute to the development of GC in Korean individuals.
26201258 Data show the important functions of TFF2 in the gastric mucus barrier, mucus epithelia, immune system, central nervous system, and during fertilization. It has been shown to interact with the gastric mucin MUC6. [Review]
25899003 We reproducibly associate higher expression of the ligand-receptor axis of TFF2 and CXCR4 with BRAF V600E-mutant colon cancer
25876034 protease-activated receptor 4 and Trefoil factor 2 are expressed in human colorectal cancer
25210040 The structural features of the N-linked N,N'-di-N-acetyllactosediamine-inducing determinant on human TFF2 are discussed.
25124036 Human TTF2 is a lectin that binds alpha-GlcNAc-capped mucin 6 g with antibiotic activity against Helicobacter pylori.
23933418 There is an association between TFF2 and TFF3 polymorphisms and risk of atrophic gastritis and gastric cancer in Chinese people.
23628371 Significantly higher levels of TFF2 were in patients with Multiple Organ Dysfunction Syndrome.
23000412 this study indicated that Sp3 was a major regulator of TFF2 expression.
22997242 Human gastric TFF2 peptide contains an N-linked fucosylated N,N'-diacetyllactosediamine (LacdiNAc) oligosaccharide
More...

AA Sequence

MGRRDAQLLAALLVLGLCALAGSEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCF      1 - 70
HPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY                71 - 129
//

Text Mined References (65)

PMID Year Title
26240479 2015 Association between Promoter Polymorphisms of TFF1, TFF2, and TFF3 and the Risk of Gastric and Diffuse Gastric Cancers in a Korean Population.
26201258 2015 TFF2, a MUC6-binding lectin stabilizing the gastric mucus barrier and more (Review).
25899003 2015 TFF2-CXCR4 Axis Is Associated with BRAF V600E Colon Cancer.
25876034 2015 Increased expression of protease-activated receptor 4 and Trefoil factor 2 in human colorectal cancer.
25210040 2014 Trefoil factor family domains represent highly efficient conformational determinants for N-linked N,N'-di-N-acetyllactosediamine (LacdiNAc) synthesis.
25124036 2014 Human trefoil factor 2 is a lectin that binds ?-GlcNAc-capped mucin glycans with antibiotic activity against Helicobacter pylori.
23933418 2013 Promoter polymorphisms in trefoil factor 2 and trefoil factor 3 genes and susceptibility to gastric cancer and atrophic gastritis among Chinese population.
23628371 2013 Trefoil factor 2 expression and its significance as a predictor of severity of sepsis in children.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23000412 2012 The regulation of trefoil factor 2 expression by the transcription factor Sp3.
More...