Property Summary

NCBI Gene PubMed Count 50
PubMed Score 1476.89
PubTator Score 194.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
6-pyruvoyl-tetrahydropterin synthase deficiency 1 0.0 0.0
Disease Target Count Z-score Confidence
Phenylketonuria 20 0.0 4.0

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.400 1.2e-02
ependymoma -1.200 4.5e-02
hereditary spastic paraplegia -1.277 2.0e-03
lung cancer 1.300 8.3e-03
Multiple myeloma 1.326 2.9e-03
non-small cell lung cancer 1.017 2.6e-14
oligodendroglioma -1.300 2.2e-02
ovarian cancer 2.500 6.7e-06
pancreatic ductal adenocarcinoma liver m... -1.235 9.5e-04

Protein-protein Interaction (4)

Gene RIF (16)

AA Sequence

MSTEGGGRRCQAQVSRRISFSASHRLYSKFLSDEENLKLFGKCNNPNGHGHNYKVVVTVHGEIDPATGMV      1 - 70
MNLADLKKYMEEAIMQPLDHKNLDMDVPYFADVVSTTENVAVYIWDNLQKVLPVGVLYKVKVYETDNNIV     71 - 140
VYKGE                                                                     141 - 145
//

Text Mined References (57)

PMID Year Title