Property Summary

NCBI Gene PubMed Count 38
Grant Count 10
R01 Count 10
Funding $1,065,347.82
PubMed Score 96.49
PubTator Score 74.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Gene RIF (23)

PMID Text
25954030 Mutation of the nuclear lamin gene LMNB2 in progressive myoclonus epilepsy with early ataxia.
25477337 Nuclear envelope remodelling during human spermiogenesis involves somatic B-type lamins and a spermatid-specific B3 lamin isoform.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of lamin B2 (LMNB2) expression by HIV-1 Vpr in Vpr transduced macrophages
23475125 Treating normal human fibroblasts with farnesyltransferase inhibitors causes the accumulation of unprocessed lamin B2 and lamin A and a decrease in mature lamin B1
22768673 Mutation in LMNB2 gene is associated with partial lipodystrophy.
21400569 Studies indicate that the lamin-binding proteins implicated in laminopathies include lamin B2 and nuclear envelope proteins.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20004208 These findings indicate that a lamin dimer principally has the freedom for a "combinatorial" head-to-tail association with all types of lamins, a property that might be of significant importance for the assembly of the nuclear lamina.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
More...

AA Sequence

MSPPSPGRRREQRRPRAAATMATPLPGRAGGPATPLSPTRLSRLQEKEELRELNDRLAHYIDRVRALELE      1 - 70
NDRLLLKISEKEEVTTREVSGIKALYESELADARRVLDETARERARLQIEIGKLRAELDEVNKSAKKREG     71 - 140
ELTVAQGRVKDLESLFHRSEVELAAALSDKRGLESDVAELRAQLAKAEDGHAVAKKQLEKETLMRVDLEN    141 - 210
RCQSLQEELDFRKSVFEEEVRETRRRHERRLVEVDSSRQQEYDFKMAQALEELRSQHDEQVRLYKLELEQ    211 - 280
TYQAKLDSAKLSSDQNDKAASAAREELKEARMRLESLSYQLSGLQKQASAAEDRIRELEEAMAGERDKFR    281 - 350
KMLDAKEQEMTEMRDVMQQQLAEYQELLDVKLALDMEINAYRKLLEGEEERLKLSPSPSSRVTVSRATSS    351 - 420
SSGSLSATGRLGRSKRKRLEVEEPLGSGPSVLGTGTGGSGGFHLAQQASASGSVSIEEIDLEGKFVQLKN    421 - 490
NSDKDQSLGNWRIKRQVLEGEEIAYKFTPKYILRAGQMVTVWAAGAGVAHSPPSTLVWKGQSSWGTGESF    491 - 560
RTVLVNADGEEVAMRTVKKSSVMRENENGEEEEEEAEFGEEDLFHQQGDPRTTSRGCYVM              561 - 620
//

Text Mined References (53)

PMID Year Title
25954030 2015 Mutation of the nuclear lamin gene LMNB2 in progressive myoclonus epilepsy with early ataxia.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25477337 2015 Nuclear envelope remodelling during human spermiogenesis involves somatic B-type lamins and a spermatid-specific B3 lamin isoform.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23475125 Disruption of lamin B1 and lamin B2 processing and localization by farnesyltransferase inhibitors.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22768673 2012 A Chinese patient with acquired partial lipodystrophy caused by a novel mutation with LMNB2 gene.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21400569 2011 Laminopathies and lamin-associated signaling pathways.
More...