Property Summary

NCBI Gene PubMed Count 40
PubMed Score 99.05
PubTator Score 74.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Atopic dermatitis 1.400 5.8e-04
atypical teratoid / rhabdoid tumor 1.200 1.1e-05
Breast cancer 1.200 2.9e-10
colon cancer 1.400 5.2e-03
Endometriosis 1.332 1.5e-02
group 3 medulloblastoma 2.100 4.7e-06
intraductal papillary-mucinous carcinoma... 1.100 1.2e-03
lung cancer 1.100 2.5e-02
malignant mesothelioma 1.700 3.7e-06
medulloblastoma, large-cell 2.000 1.6e-06
non-small cell lung cancer 1.884 8.8e-21
ovarian cancer 1.200 2.3e-04
pediatric high grade glioma 1.100 2.1e-05
primitive neuroectodermal tumor 1.500 4.6e-05
psoriasis 1.400 2.9e-04

Gene RIF (24)

AA Sequence

MSPPSPGRRREQRRPRAAATMATPLPGRAGGPATPLSPTRLSRLQEKEELRELNDRLAHYIDRVRALELE      1 - 70
NDRLLLKISEKEEVTTREVSGIKALYESELADARRVLDETARERARLQIEIGKLRAELDEVNKSAKKREG     71 - 140
ELTVAQGRVKDLESLFHRSEVELAAALSDKRGLESDVAELRAQLAKAEDGHAVAKKQLEKETLMRVDLEN    141 - 210
RCQSLQEELDFRKSVFEEEVRETRRRHERRLVEVDSSRQQEYDFKMAQALEELRSQHDEQVRLYKLELEQ    211 - 280
TYQAKLDSAKLSSDQNDKAASAAREELKEARMRLESLSYQLSGLQKQASAAEDRIRELEEAMAGERDKFR    281 - 350
KMLDAKEQEMTEMRDVMQQQLAEYQELLDVKLALDMEINAYRKLLEGEEERLKLSPSPSSRVTVSRATSS    351 - 420
SSGSLSATGRLGRSKRKRLEVEEPLGSGPSVLGTGTGGSGGFHLAQQASASGSVSIEEIDLEGKFVQLKN    421 - 490
NSDKDQSLGNWRIKRQVLEGEEIAYKFTPKYILRAGQMVTVWAAGAGVAHSPPSTLVWKGQSSWGTGESF    491 - 560
RTVLVNADGEEVAMRTVKKSSVMRENENGEEEEEEAEFGEEDLFHQQGDPRTTSRGCYVM              561 - 620
//

Text Mined References (57)

PMID Year Title