Property Summary

NCBI Gene PubMed Count 37
Grant Count 25
R01 Count 17
Funding $2,716,201.77
PubMed Score 115.33
PubTator Score 96.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
acute myeloid leukemia 1.900 0.048

Gene RIF (20)

PMID Text
26878239 A nonhistone centromere protein, CENP-C, binds and reshapes the nucleosome, sliding the DNA gyres back to positions similar to those in canonical nucleosomes containing conventional histone H3.
26527398 CENP-C and CENP-I are key factors connecting kinetochore to CENP-A assembly.
26124289 CENP-C, a CCAN subunit, is crucial for kinetochore assembly because it links centromeres with the microtubule-binding interface of kinetochores.
25997930 HPV18 E7 inhibited the binding of CENP-C to alpha-satellite DNAs.
25954010 CENP-C affects nucleosome shape and dynamics in a manner analogous to allosteric regulation of enzymes. CENP-C depletion leads to rapid removal of CENP-A from centromeres, indicating their collaboration in maintaining centromere identity.
25942623 CENP-B directly binds both CENP-A's amino-terminal tail and CENP-C, a key nucleator of kinetochore assembly
25843710 We used a synthetic system to dissect how CenH3(CENP-A) contributes to the accumulation of CENP-C and CENP-T, two key components that are necessary for the formation of functional kinetochores
25660545 CENP-C recruits the Ndc80 complex through its interactions with KNL1 and the Mis12 complex at kinetochores during chromosome segregation.
25408271 The CENP-A/histone H3.3 nucleosome forms an unexpectedly stable structure and allows the binding of the essential centromeric protein, CENP-C, which is ectopically mislocalized in the chromosomes of CENP-A overexpressing tumor cells.
22540025 CENP-C works as an important factor for centromeric M18BP1 recruitment
More...

AA Sequence

MAASGLDHLKNGYRRRFCRPSRARDINTEQGQNVLEILQDCFEEKSLANDFSTNSTKSVPNSTRKIKDTC      1 - 70
IQSPSKECQKSHPKSVPVSSKKKEASLQFVVEPSEATNRSVQAHEVHQKILATDVSSKNTPDSKKISSRN     71 - 140
INDHHSEADEEFYLSVGSPSVLLDAKTSVSQNVIPSSAQKRETYTFENSVNMLPSSTEVSVKTKKRLNFD    141 - 210
DKVMLKKIEIDNKVSDEEDKTSEGQERKPSGSSQNRIRDSEYEIQRQAKKSFSTLFLETVKRKSESSPIV    211 - 280
RHAATAPPHSCPPDDTKLIEDEFIIDESDQSFASRSWITIPRKAGSLKQRTISPAESTALLQGRKSREKH    281 - 350
HNILPKTLANDKHSHKPHPVETSQPSDKTVLDTSYALIGETVNNYRSTKYEMYSKNAEKPSRSKRTIKQK    351 - 420
QRRKFMAKPAEEQLDVGQSKDENIHTSHITQDEFQRNSDRNMEEHEEMGNDCVSKKQMPPVGSKKSSTRK    421 - 490
DKEESKKKRFSSESKNKLVPEEVTSTVTKSRRISRRPSDWWVVKSEESPVYSNSSVRNELPMHHNSSRKS    491 - 560
TKKTNQSSKNIRKKTIPLKRQKTATKGNQRVQKFLNAEGSGGIVGHDEISRCSLSEPLESDEADLAKKKN    561 - 630
LDCSRSTRSSKNEDNIMTAQNVPLKPQTSGYTCNIPTESNLDSGEHKTSVLEESGPSRLNNNYLMSGKND    631 - 700
VDDEEVHGSSDDSKQSKVIPKNRIHHKLVLPSNTPNVRRTKRTRLKPLEYWRGERIDYQGRPSGGFVISG    701 - 770
VLSPDTISSKRKAKENIGKVNKKSNKKRICLDNDERKTNLMVNLGIPLGDPLQPTRVKDPETREIILMDL    771 - 840
VRPQDTYQFFVKHGELKVYKTLDTPFFSTGKLILGPQEEKGKQHVGQDILVFYVNFGDLLCTLHETPYIL    841 - 910
STGDSFYVPSGNYYNIKNLRNEESVLLFTQIKR                                         911 - 943
//

Text Mined References (46)

PMID Year Title
27499292 2016 The Flexible Ends of CENP-A Nucleosome Are Required for Mitotic Fidelity.
26878239 2016 CENP-C directs a structural transition of CENP-A nucleosomes mainly through sliding of DNA gyres.
26527398 2015 CENP-C and CENP-I are key connecting factors for kinetochore and CENP-A assembly.
26124289 2015 CENP-C is a blueprint for constitutive centromere-associated network assembly within human kinetochores.
25997930 2015 The human papillomavirus18 E7 protein inhibits CENP-C binding to ?-satellite DNA.
25954010 2015 Chromosomes. CENP-C reshapes and stabilizes CENP-A nucleosomes at the centromere.
25942623 2015 DNA Sequence-Specific Binding of CENP-B Enhances the Fidelity of Human Centromere Function.
25843710 2015 HJURP involvement in de novo CenH3(CENP-A) and CENP-C recruitment.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25660545 2015 Distinct organization and regulation of the outer kinetochore KMN network downstream of CENP-C and CENP-T.
More...