Property Summary

NCBI Gene PubMed Count 37
PubMed Score 115.33
PubTator Score 96.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Expression

  Differential Expression (1)

Disease log2 FC p
acute myeloid leukemia 1.900 0.048

Synonym

Accession Q03188 Q6PIR0 Q8IW27 Q9P0M5 CENP-C
Symbols MIF2
hcp-4
CENP-C
CENPC1

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG

Gene RIF (20)

PMID Text
26878239 A nonhistone centromere protein, CENP-C, binds and reshapes the nucleosome, sliding the DNA gyres back to positions similar to those in canonical nucleosomes containing conventional histone H3.
26527398 CENP-C and CENP-I are key factors connecting kinetochore to CENP-A assembly.
26124289 CENP-C, a CCAN subunit, is crucial for kinetochore assembly because it links centromeres with the microtubule-binding interface of kinetochores.
25997930 HPV18 E7 inhibited the binding of CENP-C to alpha-satellite DNAs.
25954010 CENP-C affects nucleosome shape and dynamics in a manner analogous to allosteric regulation of enzymes. CENP-C depletion leads to rapid removal of CENP-A from centromeres, indicating their collaboration in maintaining centromere identity.
25942623 CENP-B directly binds both CENP-A's amino-terminal tail and CENP-C, a key nucleator of kinetochore assembly
25843710 We used a synthetic system to dissect how CenH3(CENP-A) contributes to the accumulation of CENP-C and CENP-T, two key components that are necessary for the formation of functional kinetochores
25660545 CENP-C recruits the Ndc80 complex through its interactions with KNL1 and the Mis12 complex at kinetochores during chromosome segregation.
25408271 The CENP-A/histone H3.3 nucleosome forms an unexpectedly stable structure and allows the binding of the essential centromeric protein, CENP-C, which is ectopically mislocalized in the chromosomes of CENP-A overexpressing tumor cells.
22540025 CENP-C works as an important factor for centromeric M18BP1 recruitment
More...

AA Sequence

MAASGLDHLKNGYRRRFCRPSRARDINTEQGQNVLEILQDCFEEKSLANDFSTNSTKSVPNSTRKIKDTC      1 - 70
IQSPSKECQKSHPKSVPVSSKKKEASLQFVVEPSEATNRSVQAHEVHQKILATDVSSKNTPDSKKISSRN     71 - 140
INDHHSEADEEFYLSVGSPSVLLDAKTSVSQNVIPSSAQKRETYTFENSVNMLPSSTEVSVKTKKRLNFD    141 - 210
DKVMLKKIEIDNKVSDEEDKTSEGQERKPSGSSQNRIRDSEYEIQRQAKKSFSTLFLETVKRKSESSPIV    211 - 280
RHAATAPPHSCPPDDTKLIEDEFIIDESDQSFASRSWITIPRKAGSLKQRTISPAESTALLQGRKSREKH    281 - 350
HNILPKTLANDKHSHKPHPVETSQPSDKTVLDTSYALIGETVNNYRSTKYEMYSKNAEKPSRSKRTIKQK    351 - 420
QRRKFMAKPAEEQLDVGQSKDENIHTSHITQDEFQRNSDRNMEEHEEMGNDCVSKKQMPPVGSKKSSTRK    421 - 490
DKEESKKKRFSSESKNKLVPEEVTSTVTKSRRISRRPSDWWVVKSEESPVYSNSSVRNELPMHHNSSRKS    491 - 560
TKKTNQSSKNIRKKTIPLKRQKTATKGNQRVQKFLNAEGSGGIVGHDEISRCSLSEPLESDEADLAKKKN    561 - 630
LDCSRSTRSSKNEDNIMTAQNVPLKPQTSGYTCNIPTESNLDSGEHKTSVLEESGPSRLNNNYLMSGKND    631 - 700
VDDEEVHGSSDDSKQSKVIPKNRIHHKLVLPSNTPNVRRTKRTRLKPLEYWRGERIDYQGRPSGGFVISG    701 - 770
VLSPDTISSKRKAKENIGKVNKKSNKKRICLDNDERKTNLMVNLGIPLGDPLQPTRVKDPETREIILMDL    771 - 840
VRPQDTYQFFVKHGELKVYKTLDTPFFSTGKLILGPQEEKGKQHVGQDILVFYVNFGDLLCTLHETPYIL    841 - 910
STGDSFYVPSGNYYNIKNLRNEESVLLFTQIKR                                         911 - 943
//

Text Mined References (46)

PMID Year Title
27499292 2016 The Flexible Ends of CENP-A Nucleosome Are Required for Mitotic Fidelity.
26878239 2016 CENP-C directs a structural transition of CENP-A nucleosomes mainly through sliding of DNA gyres.
26527398 2015 CENP-C and CENP-I are key connecting factors for kinetochore and CENP-A assembly.
26124289 2015 CENP-C is a blueprint for constitutive centromere-associated network assembly within human kinetochores.
25997930 2015 The human papillomavirus18 E7 protein inhibits CENP-C binding to ?-satellite DNA.
25954010 2015 Chromosomes. CENP-C reshapes and stabilizes CENP-A nucleosomes at the centromere.
25942623 2015 DNA Sequence-Specific Binding of CENP-B Enhances the Fidelity of Human Centromere Function.
25843710 2015 HJURP involvement in de novo CenH3(CENP-A) and CENP-C recruitment.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25660545 2015 Distinct organization and regulation of the outer kinetochore KMN network downstream of CENP-C and CENP-T.
More...