Property Summary

NCBI Gene PubMed Count 274
Grant Count 132
R01 Count 86
Funding $13,772,360.21
PubMed Score 307.39
PubTator Score 507.40

Knowledge Summary

Patent (10,291)

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 1.500 0.000
astrocytoma 1.100 0.046
medulloblastoma, large-cell -1.900 0.000
intraductal papillary-mucinous carcinoma... 1.500 0.002
ovarian cancer 1.500 0.000

Synonym

Accession Q03181 A8K6J6 B4E3V3 B6ZGS1 B7Z3W1 E9PE18 Q5D1P0 Q7Z5K0 Q9BUD4 PPAR-delta
Symbols FAAR
NUC1
NUCI
NR1C2
NUCII
PPARB

Gene

PDB

1GWX   1Y0S   2AWH   2B50   2BAW   2ENV   2GWX   2J14   2Q5G   2XYJ   2XYW   2XYX   2ZNP   2ZNQ   3D5F   3DY6   3ET2   3GWX   3GZ9   3OZ0   3PEQ   3SP9   3TKM  

  TechDev Info (1)

Jun Qin Signaling network evaluation of transcript factor crosstalk via catTRE/MS

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors

Gene RIF (256)

PMID Text
26921399 Data suggest enhancement of hepatocyte mitochondrial biogenesis and beta-oxidation by all-trans-retinoic acid requires peroxisome proliferator activated receptor delta; retinoic acid receptor alpha/beta do not appear to be involved in this response.
26915488 Polymorphism of rs2016520 in gene PPARD was associated with benign metabolic traits in a large cohort of Chinese adults
26871769 LncPPARd can be a biomarker for coronary artery disease (CAD). The regulation of LncPPARd on expression of its neighboring protein-coding gene PPARd and direct target genes PPARd, ADRP, and ANGPTL4 may be involved in CAD pathogenesis.
26673968 No association was found between PPARgamma2 C161T single nucleotide polymorphisms with obesity and metabolic syndrome in a multi-ethnic population in Kampar, Malaysia.
26613934 Essential hypertension risk is associated with SNP-SNP interactions in a Chinese population.
26481780 PPAR delta plays pivotal roles in wound healing by promoting fibroblast-to-myofibroblast differentiation via transforming growth factor-beta/Smad3 signaling.
26443862 studies identify a novel PPRE-mediated regulatory mechanism for LDLR transcription and suggest that combined treatment of statin with PPARdelta agonists may have advantageous effects on LDLR expression.
26346611 The PPARdelta+294C allele maybe an independent risk of IS in Chinese Uyghurs especially in the male and obesity populations.
26322419 Studied the role of WNT/beta-catenin signaling via the PPARdelta/p38 pathway in cigarette smoke (CS)-related airway inflammation using patient lung tissues, human bronchial epithelial cells (16HBECs), and mouse models.
26227398 It plays a role in insulin sensitivity.
More...

AA Sequence

MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSSPPSLLDQLQMGCDGASCGSL      1 - 70
NMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKKNRNKCQYCRFQKCLALGMSH     71 - 140
NAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAP    141 - 210
FVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVT    211 - 280
LLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLAL    281 - 350
FIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRI    351 - 420
KKTETETSLHPLLQEIYKDMY                                                     421 - 441
//

Text Mined References (283)

PMID Year Title
26921399 2016 All-Trans-Retinoic Acid Enhances Mitochondrial Function in Models of Human Liver.
26915488 2016 PPARD rs2016520 polymorphism is associated with metabolic traits in a large population of Chinese adults.
26871769 2016 Circulating "LncPPAR?" From Monocytes as a Novel Biomarker for Coronary Artery Diseases.
26673968 2015 Screening of Peroxisome Proliferator-Activated Receptors (PPARs) ?, ? and ? Gene Polymorphisms for Obesity and Metabolic Syndrome Association in the Multi-Ethnic Malaysian Population.
26613934 2016 Case-control study on association of peroxisome proliferator-activated receptor-? and SNP-SNP interactions with essential hypertension in Chinese Han population.
26504087 2015 Reactive Oxygen Species (ROS) Mediate p300-dependent STAT1 Protein Interaction with Peroxisome Proliferator-activated Receptor (PPAR)-? in CD36 Protein Expression and Foam Cell Formation.
26481780 2015 Ligand-activated PPAR? upregulates ?-smooth muscle actin expression in human dermal fibroblasts: A potential role for PPAR? in wound healing.
26443862 2015 A novel peroxisome proliferator response element modulates hepatic low-density lipoprotein receptor gene transcription in response to PPAR? activation.
26346611 2015 Association of functional genetic variants in PPAR? encoding peroxisome proliferator-activated receptor delta with ischemic stroke in Chinese Uyghur population.
26322419 2016 WNT/?-catenin signaling regulates cigarette smoke-induced airway inflammation via the PPAR?/p38 pathway.
More...