Property Summary

NCBI Gene PubMed Count 20
PubMed Score 55.41
PubTator Score 28.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Rheumatoid Arthritis 1171
Disease Target Count P-value
lung carcinoma 2844 6.36121420293141E-22
ovarian cancer 8492 1.82527431166986E-7
osteosarcoma 7933 3.52578520349558E-7
lung cancer 4473 5.63629912475217E-6
posterior fossa group A ependymoma 1511 5.98804212990321E-5
psoriasis 6685 1.38672180285837E-4
cystic fibrosis 1670 9.92424983021788E-4
glioblastoma 5572 0.00148309809457495
head and neck cancer 270 0.00242787126877161
pancreatic cancer 2300 0.00328841049928693
interstitial cystitis 2299 0.00469516887098338
Gaucher disease type 1 171 0.00488483199443274
adrenocortical carcinoma 1427 0.00517926803111397
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00562829361312511
active ulcerative colitis 477 0.011545580081589
gastric carcinoma 832 0.0211321681374448
subependymal giant cell astrocytoma 2287 0.0273418443188847
mucosa-associated lymphoid tissue lymphoma 480 0.0462822446194659
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0468221002700346
X-linked cerebral adrenoleukodystrophy 115 0.0474049832014743

Expression

Synonym

Accession Q03169 Q86VI0 TNF alpha-induced protein 2
Symbols B94
EXOC3L3

Gene

PANTHER Protein Class (1)

  Ortholog (12)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Zebrafish OMA EggNOG Inparanoid

Gene RIF (15)

PMID Text
26347487 data suggest that TNFAIP2 is a novel inhibitor of NF-kappa-B that acts as an autoinhibitor of the TNFalpha response during septic shock.
26189798 findings collectively suggest that TNFAIP2 is a direct KLF5 target gene, and both KLF5 and TNFAIP2 promote breast cancer cell proliferation, migration and invasion through Rac1 and Cdc42
25383966 A functional TNFAIP2 3'-UTR rs8126 genetic polymorphism contributes to risk of esophageal squamous cell carcinoma.
23975427 the regulation of TNFAIP2 and its role in promoting NPC tumor progression
23724109 The TNFAIP2 miRNA binding site rs8126 T>C single nucleotide polymorphism may be a marker for susceptibility to gastric cancer.
21934093 A functional variant at the miR-184 binding site in TNFAIP2 is associated with squamous cell carcinoma of the head and neck.
21921781 TNFAIP2 may serve as a useful new marker of dendritic and histiocytic sarcomas.
21555518 TNFAIP2 is a target gene of the BACH1 transcription factor according to ChIP-seq analysis in HEK 293 cells.
21057457 TNFAIP2 is a cell migration-promoting protein and its expression predicts distant metastasis. Our data suggest that TNFAIP2 may serve as an independent prognostic indicator for nasopharyngeal carcinoma.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSEASSEDLVPPLEAGAAPYREEEEAAKKKKEKKKKSKGLANVFCVFTKGKKKKGQPSSAEPEDAAGSRQ      1 - 70
GLDGPPPTVEELKAALERGQLEAARPLLALERELAAAAAAGGVSEEELVRRQSKVEALYELLRDQVLGVL     71 - 140
RRPLEAPPERLRQALAVVAEQEREDRQAAAAGPGTSGLAATRPRRWLQLWRRGVAEAAEERMGQRPAAGA    141 - 210
EVPESVFLHLGRTMKEDLEAVVERLKPLFPAEFGVVAAYAESYHQHFAAHLAAVAQFELCERDTYMLLLW    211 - 280
VQNLYPNDIINSPKLVGELQGMGLGSLLPPRQIRLLEATFLSSEAANVRELMDRALELEARRWAEDVPPQ    281 - 350
RLDGHCHSELAIDIIQITSQAQAKAESITLDLGSQIKRVLLVELPAFLRSYQRAFNEFLERGKQLTNYRA    351 - 420
NVIANINNCLSFRMSMEQNWQVPQDTLSLLLGPLGELKSHGFDTLLQNLHEDLKPLFKRFTHTRWAAPVE    421 - 490
TLENIIATVDTRLPEFSELQGCFREELMEALHLHLVKEYIIQLSKGRLVLKTAEQQQQLAGYILANADTI    491 - 560
QHFCTQHGSPATWLQPALPTLAEIIRLQDPSAIKIEVATYATCYPDFSKGHLSAILAIKGNLSNSEVKRI    561 - 630
RSILDVSMGAQEPSRPLFSLIKVG                                                  631 - 654
//

Text Mined References (21)

PMID Year Title
26347487 2016 TNFAIP2 Inhibits Early TNF?-Induced NF-x03BA;B Signaling and Decreases Survival in Septic Shock Patients.
26189798 2016 KLF5 promotes breast cancer proliferation, migration and invasion in part by upregulating the transcription of TNFAIP2.
25383966 2014 A functional TNFAIP2 3'-UTR rs8126 genetic polymorphism contributes to risk of esophageal squamous cell carcinoma.
23975427 2014 NF-?B-mediated transcriptional upregulation of TNFAIP2 by the Epstein-Barr virus oncoprotein, LMP1, promotes cell motility in nasopharyngeal carcinoma.
23724109 2013 The miR-184 binding-site rs8126 T>C polymorphism in TNFAIP2 is associated with risk of gastric cancer.
21934093 2011 A functional variant at the miR-184 binding site in TNFAIP2 and risk of squamous cell carcinoma of the head and neck.
21921781 2011 Aberrant expression of the dendritic cell marker TNFAIP2 by the malignant cells of Hodgkin lymphoma and primary mediastinal large B-cell lymphoma distinguishes these tumor types from morphologically and phenotypically similar lymphomas.
21555518 2011 The BTB and CNC homology 1 (BACH1) target genes are involved in the oxidative stress response and in control of the cell cycle.
21399635 2011 Genome-wide association study identifies 12 new susceptibility loci for primary biliary cirrhosis.
21057457 2011 A novel role for TNFAIP2: its correlation with invasion and metastasis in nasopharyngeal carcinoma.
More...