Property Summary

NCBI Gene PubMed Count 123
Grant Count 51
R01 Count 24
Funding $7,294,832.21
PubMed Score 73.11
PubTator Score 121.07

Knowledge Summary

Patent

No data available

Expression

Gene RIF (98)

PMID Text
26548418 No correlation of loss of heterozygosity at the TGFBR3 locus with clinicopathological parameters suggests that allelic imbalance may be an early genetic event during neoplastic transformation of human endometrium.
26531330 Study shows that TbetaRIII expression is significantly decreased in salivary glands adenoid cystic carcinoma (ACC) patients and defines TbetaRIII as a biomarker exerting antitumor action on ACC progression.
26383992 The presence of the index SNP rs1192415 (TGFBR3-CDC7) was associated with visual field progression in POAG (primary open-angle glaucoma) patients.
26205654 results suggest overexpression of TbetaRIII receptor restored TGF-beta1 sensitivity in CAL-27 cells
26190421 Data suggest a high potential of plasma sTBFbetarIII as a novel diagnostic and prognostic biomarker in breast cancer.
25861811 rs1192415 of TGFBR3 is associated with primary open angle glaucoma.
25728278 Data indicate that TGF-beta2 (TGFB2) and TGF beta type III receptor (TGFBR3) are target genes of miR-193b in chondrogenesis.
25728212 Study shows that GDF10 is down-regulated in patients with oral squamous cell carcinoma, and is an independent risk factor for overall survival. Its expression is regulated by TGFBR3 which shares the signaling inhibiting epithelial-mesenchymal transition.
25677673 RS1805110 is not associated with Behcet's disease or idiopathic intermediate uveitis in Caucasian patients.
25390077 data suggest complex or phenotype specific association of cryptorchidism with TGFBR3 and the gubernaculum as a potential target of TGFbeta signaling
More...

AA Sequence

MTSHYVIAIFALMSSCLATAGPEPGALCELSPVSASHPVQALMESFTVLSGCASRGTTGLPQEVHVLNLR      1 - 70
TAGQGPGQLQREVTLHLNPISSVHIHHKSVVFLLNSPHPLVWHLKTERLATGVSRLFLVSEGSVVQFSSA     71 - 140
NFSLTAETEERNFPHGNEHLLNWARKEYGAVTSFTELKIARNIYIKVGEDQVFPPKCNIGKNFLSLNYLA    141 - 210
EYLQPKAAEGCVMSSQPQNEEVHIIELITPNSNPYSAFQVDITIDIRPSQEDLEVVKNLILILKCKKSVN    211 - 280
WVIKSFDVKGSLKIIAPNSIGFGKESERSMTMTKSIRDDIPSTQGNLVKWALDNGYSPITSYTMAPVANR    281 - 350
FHLRLENNAEEMGDEEVHTIPPELRILLDPGALPALQNPPIRGGEGQNGGLPFPFPDISRRVWNEEGEDG    351 - 420
LPRPKDPVIPSIQLFPGLREPEEVQGSVDIALSVKCDNEKMIVAVEKDSFQASGYSGMDVTLLDPTCKAK    421 - 490
MNGTHFVLESPLNGCGTRPRWSALDGVVYYNSIVIQVPALGDSSGWPDGYEDLESGDNGFPGDMDEGDAS    491 - 560
LFTRPEIVVFNCSLQQVRNPSSFQEQPHGNITFNMELYNTDLFLVPSQGVFSVPENGHVYVEVSVTKAEQ    561 - 630
ELGFAIQTCFISPYSNPDRMSHYTIIENICPKDESVKFYSPKRVHFPIPQADMDKKRFSFVFKPVFNTSL    631 - 700
LFLQCELTLCTKMEKHPQKLPKCVPPDEACTSLDASIIWAMMQNKKTFTKPLAVIHHEAESKEKGPSMKE    701 - 770
PNPISPPIFHGLDTLTVMGIAFAAFVIGALLTGALWYIYSHTGETAGRQQVPTSPPASENSSAAHSIGST    771 - 840
QSTPCSSSSTA                                                               841 - 851
//

Text Mined References (125)

PMID Year Title
26548418 2016 Significance of TGFBR3 allelic loss in the deregulation of TGF? signaling in primary human endometrial carcinomas.
26531330 2016 Type III TGF-? receptor inhibits cell proliferation and migration in salivary glands adenoid cystic carcinoma by suppressing NF-?B signaling.
26383992 2015 A Genetic Variant in TGFBR3-CDC7 Is Associated with Visual Field Progression in Primary Open-Angle Glaucoma Patients from Singapore.
26205654 2015 Overexpression of transforming growth factor type III receptor restores TGF-?1 sensitivity in human tongue squamous cell carcinoma cells.
26190421 2015 Soluble type III TGF? receptor in diagnosis and follow-up of patients with breast cancer.
25861811 2015 A common variant near TGFBR3 is associated with primary open angle glaucoma.
25728278 2015 MiR-193b regulates early chondrogenesis by inhibiting the TGF-beta2 signaling pathway.
25728212 2016 Loss of GDF10/BMP3b as a prognostic marker collaborates with TGFBR3 to enhance chemotherapy resistance and epithelial-mesenchymal transition in oral squamous cell carcinoma.
25677673 2015 Association analysis of TGFBR3 gene with Behçet's disease and idiopathic intermediate uveitis in a Caucasian population.
25390077 2015 Phenotype specific association of the TGFBR3 locus with nonsyndromic cryptorchidism.
More...