Property Summary

NCBI Gene PubMed Count 360
Grant Count 218
R01 Count 102
Funding $20,411,169.81
PubMed Score 665.96
PubTator Score 1333.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Synonym

Accession Q03164 E9PQG7 Q13743 Q13744 Q14845 Q16364 Q59FF2 Q6UBD1 Q9HBJ3 Q9UD94 Q9UMA3 Lysine N-methyltransferase 2A
Symbols HRX
MLL
MLL1
TRX1
ALL-1
CXXC7
HTRX1
MLL1A
WDSTS
MLL-AF9
MLL/GAS7
TET1-MLL

Gene

PDB

2KU7   3EG6   3EMH   3P4F   4ESG   2MSR   2MTN   3U88   2LXS   2LXT   3U85   4GQ6   5F6L   2AGH   2J2S   2JYI   2KKF   2KYU   2W5Y   2W5Z   3LQH   3LQI   3LQJ   4NW3   5F5E  

MLP Assay (11)

AID Type Active / Inconclusive / Inactive Description
1766 confirmatory 0 / 9265 / 283245 qHTS Assay for Inhibitors Targeting the Menin-MLL Interaction in MLL Related Leukemias: Competition With Fluorescein Labeled MLL-derived Peptide
1768 confirmatory 615 / 31902 / 234159 qHTS Assay for Inhibitors Targeting the Menin-MLL Interaction in MLL Related Leukemias: Competition With Texas Red Labeled MLL-derived Mutant Peptide
2076 summary 0 / 0 / 0 qHTS Assay for Inhibitors Targeting the Menin-MLL Interaction in MLL Related Leukemias: Summary
2662 confirmatory 110 / 8748 / 286120 qHTS Fluorescence Polarization Assay for Inhibitors of MLL CXXC domain - DNA interaction
2698 summary 0 / 0 / 0 qHTS Fluorescence Polarization Assay for Inhibitors of MLL CXXC domain - DNA interaction: Summary
2778 confirmatory 23 / 72 / 247 Confirmation of Inhibitors Targeting the Menin-MLL Interaction in MLL Related Leukemias: Confirmation in an HTRF (commercial TR-FRET) Assay using His-tagged menin and biotin-labeled MLL peptide
2782 confirmatory 51 / 146 / 145 Confirmation of Inhibitors Targeting the Menin-MLL Interaction in MLL Related Leukemias: Competition With Texas Red Labeled MLL-derived Mutant Peptide
2783 confirmatory 24 / 59 / 259 Confirmation of Inhibitors Targeting the Menin-MLL Interaction in MLL Related Leukemias: Competition With Fluorescein Labeled MLL-derived Peptide
504537 confirmatory 22 / 71 / 11 Inhibitor SAR for Compounds Targeting the Menin-MLL Interaction in MLL Related Leukemias: Competition With Fluorescein Labeled MLL-derived Peptide
504585 other 9 / 11 / 8 Confirmation of Inhibitors Targeting the Menin-MLL Interaction in MLL Related Leukemias: Binding Confirmation with NMR Saturation Transfer Difference
More...

Gene RIF (304)

PMID Text
26990989 Our findings define SON as a fine-tuner of the MLL-menin interaction and reveal short SON overexpression as a marker indicating aberrant transcriptional initiation in leukemia.
26970896 Data show that lysine-specific demethylase 1 (LSD1) is a drug target for mixed lineage leukemia (MLL)-rearranged leukemia, and LSD1 inhibitors are potential therapeutics for the malignancy.
26927674 MLL1 and DOT1L cooperate with meningioma-1 to induce acute myeloid leukemia.
26886794 a minimized human RBBP5-ASH2L heterodimer is the structural unit that interacts with and activates all MLL family histone methyltransferases
26833731 findings reveal direct MLL1 epigenetic control over proproliferative cell cycle genes: MLL1 inhibition represses expression of proproliferative cell cycle regulators required for DNA replication and DDR activation, thus disabling SASP expression.
26791235 Identify of MLL-fusion/MYC dash, verticalmiR-26 dash, verticalTET1 signaling circuit in MLL-rearranged acute myeloid leukemia.
26762252 Study shows that MLL-AF9 influences gene expression involved in cell cycle, Wnt signaling, the cellular response to stress, adhesion as well as myeloid differentiation via miRNA expression.
26711341 Whereas Set1 targets are largely associated with the maintenance of the stem cell population, MLL1/2 targets are specifically enriched for genes involved in ciliogenesis.
26690532 In the title.
26593443 AEP coactivator complex facilitates the initiation of RNAP2-dependent transcription via SL1 activity by loading TBP onto the TATA element.
More...

AA Sequence

MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSS      1 - 70
GAGVPGGAAAASAASSSSASSSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGG     71 - 140
GSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPRSGSDRNSAILSDPSVFSPLNKSETKSGDKI    141 - 210
KKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKIKKLRAGKLSP    211 - 280
LKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQ    281 - 350
SPRRIKPVRIIPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSR    351 - 420
IIKTPRRFIEDEDYDPPIKIARLESTPNSRFSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDS    421 - 490
QASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGSRTTKKLSTLQSAPQQQTSSS    491 - 560
PPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQ    561 - 630
YFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAP    631 - 700
RFTPSEAHSRIFESVTLPSNRTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPL    701 - 770
TPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESAEKNQRPRKQTSAPAEPFSSSSPTPLFPWFT    771 - 840
PGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQSSSALYPVGR    841 - 910
VSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTA    911 - 980
PSLEKEKTLCLSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPK    981 - 1050
AQGQESDSSETSVRGPRIKHVCRRAAVALGRKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSE   1051 - 1120
DAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVCTNCLDKPKFGGRNIKKQCCK   1121 - 1190
MRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE   1191 - 1260
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKK   1261 - 1330
QPPPPESGPEQSKQKKVAPRPSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHR   1331 - 1400
IRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASSGHVEFVYCQVCCEPFHKFCLEENERPLEDQ   1401 - 1470
LENWCCRRCKFCHVCGRQHQATKQLLECNKCRNSYHPECLGPNYPTKPTKKKKVWICTKCVRCKSCGSTT   1471 - 1540
PGKGWDAQWSHDFSLCHDCAKLFAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSDEMYEIL   1541 - 1610
SNLPESVAYTCVNCTERHPAEWRLALEKELQISLKQVLTALLNSRTTSHLLRYRQAAKPPDLNPETEESI   1611 - 1680
PSRSSPEGPDPPVLTEVSKQDDQQPLDLEGVKRKMDQGNYTSVLEFSDDIVKIIQAAINSDGGQPEIKKA   1681 - 1750
NSMVKSFFIRQMERVFPWFSVKKSRFWEPNKVSSNSGMLPNAVLPPSLDHNYAQWQEREENSHTEQPPLM   1751 - 1820
KKIIPAPKPKGPGEPDSPTPLHPPTPPILSTDRSREDSPELNPPPGIEDNRQCALCLTYGDDSANDAGRL   1821 - 1890
LYIGQNEWTHVNCALWSAEVFEDDDGSLKNVHMAVIRGKQLRCEFCQKPGATVGCCLTSCTSNYHFMCSR   1891 - 1960
AKNCVFLDDKKVYCQRHRDLIKGEVVPENGFEVFRRVFVDFEGISLRRKFLNGLEPENIHMMIGSMTIDC   1961 - 2030
LGILNDLSDCEDKLFPIGYQCSRVYWSTTDARKRCVYTCKIVECRPPVVEPDINSTVEHDENRTIAHSPT   2031 - 2100
SFTESSSKESQNTAEIISPPSPDRPPHSQTSGSCYYHVISKVPRIRTPSYSPTQRSPGCRPLPSAGSPTP   2101 - 2170
TTHEIVTVGDPLLSSGLRSIGSRRHSTSSLSPQRSKLRIMSPMRTGNTYSRNNVSSVSTTGTATDLESSA   2171 - 2240
KVVDHVLGPLNSSTSLGQNTSTSSNLQRTVVTVGNKNSHLDGSSSSEMKQSSASDLVSKSSSLKGEKTKV   2241 - 2310
LSSKSSEGSAHNVAYPGIPKLAPQVHNTTSRELNVSKIGSFAEPSSVSFSSKEALSFPHLHLRGQRNDRD   2311 - 2380
QHTDSTQSANSSPDEDTEVKTLKLSGMSNRSSIINEHMGSSSRDRRQKGKKSCKETFKEKHSSKSFLEPG   2381 - 2450
QVTTGEEGNLKPEFMDEVLTPEYMGQRPCNNVSSDKIGDKGLSMPGVPKAPPMQVEGSAKELQAPRKRTV   2451 - 2520
KVTLTPLKMENESQSKNALKESSPASPLQIESTSPTEPISASENPGDGPVAQPSPNNTSCQDSQSNNYQN   2521 - 2590
LPVQDRNLMLPDGPKPQEDGSFKRRYPRRSARARSNMFFGLTPLYGVRSYGEEDIPFYSSSTGKKRGKRS   2591 - 2660
AEGQVDGADDLSTSDEDDLYYYNFTRTVISSGGEERLASHNLFREEEQCDLPKISQLDGVDDGTESDTSV   2661 - 2730
TATTRKSSQIPKRNGKENGTENLKIDRPEDAGEKEHVTKSSVGHKNEPKMDNCHSVSRVKTQGQDSLEAQ   2731 - 2800
LSSLESSRRVHTSTPSDKNLLDTYNTELLKSDSDNNNSDDCGNILPSDIMDFVLKNTPSMQALGESPESS   2801 - 2870
SSELLNLGEGLGLDSNREKDMGLFEVFSQQLPTTEPVDSSVSSSISAEEQFELPLELPSDLSVLTTRSPT   2871 - 2940
VPSQNPSRLAVISDSGEKRVTITEKSVASSESDPALLSPGVDPTPEGHMTPDHFIQGHMDADHISSPPCG   2941 - 3010
SVEQGHGNNQDLTRNSSTPGLQVPVSPTVPIQNQKYVPNSTDSPGPSQISNAAVQTTPPHLKPATEKLIV   3011 - 3080
VNQNMQPLYVLQTLPNGVTQKIQLTSSVSSTPSVMETNTSVLGPMGGGLTLTTGLNPSLPTSQSLFPSAS   3081 - 3150
KGLLPMSHHQHLHSFPAATQSSFPPNISNPPSGLLIGVQPPPDPQLLVSESSQRTDLSTTVATPSSGLKK   3151 - 3220
RPISRLQTRKNKKLAPSSTPSNIAPSDVVSNMTLINFTPSQLPNHPSLLDLGSLNTSSHRTVPNIIKRSK   3221 - 3290
SSIMYFEPAPLLPQSVGGTAATAAGTSTISQDTSHLTSGSVSGLASSSSVLNVVSMQTTTTPTSSASVPG   3291 - 3360
HVTLTNPRLLGTPDIGSISNLLIKASQQSLGIQDQPVALPPSSGMFPQLGTSQTPSTAAITAASSICVLP   3361 - 3430
STQTTGITAASPSGEADEHYQLQHVNQLLASKTGIHSSQRDLDSASGPQVSNFTQTVDAPNSMGLEQNKA   3431 - 3500
LSSAVQASPTSPGGSPSSPSSGQRSASPSVPGPTKPKPKTKRFQLPLDKGNGKKHKVSHLRTSSSEAHIP   3501 - 3570
DQETTSLTSGTGTPGAEAEQQDTASVEQSSQKECGQPAGQVAVLPEVQVTQNPANEQESAEPKTVEEEES   3571 - 3640
NFSSPLMLWLQQEQKRKESITEKKPKKGLVFEISSDDGFQICAESIEDAWKSLTDKVQEARSNARLKQLS   3641 - 3710
FAGVNGLRMLGILHDAVVFLIEQLSGAKHCRNYKFRFHKPEEANEPPLNPHGSARAEVHLRKSAFDMFNF   3711 - 3780
LASKHRQPPEYNPNDEEEEEVQLKSARRATSMDLPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNID   3781 - 3850
AGEMVIEYAGNVIRSIQTDKREKYYDSKGIGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVINI   3851 - 3920
DGQKHIVIFAMRKIYRGEELTYDYKFPIEDASNKLPCNCGAKKCRKFLN                        3921 - 3969
//

Text Mined References (375)

PMID Year Title
26990989 2016 SON and Its Alternatively Spliced Isoforms Control MLL Complex-Mediated H3K4me3 and Transcription of Leukemia-Associated Genes.
26970896 2016 Pharmacological inhibition of LSD1 for the treatment of MLL-rearranged leukemia.
26927674 2016 MLL1 and DOT1L cooperate with meningioma-1 to induce acute myeloid leukemia.
26886794 2016 Structural basis for activity regulation of MLL family methyltransferases.
26833731 2016 MLL1 is essential for the senescence-associated secretory phenotype.
26791235 2016 Identification of MLL-fusion/MYC?miR-26?TET1 signaling circuit in MLL-rearranged leukemia.
26762252 2016 The leukemogenic fusion gene MLL-AF9 alters microRNA expression pattern and inhibits monoblastic differentiation via miR-511 repression.
26711341 2015 Set1 and MLL1/2 Target Distinct Sets of Functionally Different Genomic Loci In Vivo.
26690532 2015 Whole exome sequencing reveals a MLL de novo mutation associated with mild developmental delay and without 'hairy elbows': expanding the phenotype of Wiedemann-Steiner syndrome.
26593443 2015 AF4 uses the SL1 components of RNAP1 machinery to initiate MLL fusion- and AEP-dependent transcription.
More...