Property Summary

NCBI Gene PubMed Count 43
Grant Count 1
R01 Count 1
Funding $77,153
PubMed Score 99.68
PubTator Score 147.94

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q03154 C9J6I6 C9J9D8 C9JWD4 ACY-1
Symbols ACY-1
ACY1D
HEL-S-5

Gene

PANTHER Protein Class (3)

 Grant Application (1)

PDB

1Q7L  

Gene RIF (12)

PMID Text
24846301 ACY1 acts as a tumor suppressor in hepatocellular carcinoma.
24117009 Biochemical analysis showed absence of ACY1 enzyme activity in the patient's fibroblasts.
23739232 Report serum aminoacylase-1 as a novel biomarker with potential prognostic utility for long-term outcome in renal transplant recipients with delayed graft function.
23317546 We concluded that ACY1 expression in colorectal cancer varies with stage and appears to play a role in cell proliferation and apoptosis
21414403 aminoacylase 1 proteins with the mutations p.Arg378Trp, p.Arg378Gln and p.Arg393His were also detected in Western blot analysis
21128244 These data suggest that aminoacylase expression is dysregulated in neuroblastoma.
20480396 Case Report: ACY1-deficient patient presenting with autistic features.
18341290 T347S variant of human Acy1 exhibited markedly increased catalytic efficiency against N-benzoylamino acids
17045186 Because hK1 amidase activity is significantly lower in urine of systolic HF patients, it can be supposed that activity of renal kallikrein-kinin system may be suppressed in this systolic heart failure.
16465618 Genetic deficiency of ACY1 leads to functional ACY1 deficiency and excretion of N-acetylated amino acids.
More...

AA Sequence

MTSKGPEEEHPSVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNP      1 - 70
TLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDMKCVSIQYLEAVRRLKVEGHRFPRTIH     71 - 140
MTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRF    141 - 210
MEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPD    211 - 280
VDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMNLTLEPEIMPAATDNR    281 - 350
YIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASVPALPSDS                351 - 408
//

Text Mined References (48)

PMID Year Title
24846301 2014 Proteomics-based identification of the tumor suppressor role of aminoacylase 1 in hepatocellular carcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24117009 2014 Aminoacylase I deficiency due to ACY1 mRNA exon skipping.
23739232 2013 Serum aminoacylase-1 is a novel biomarker with potential prognostic utility for long-term outcome in patients with delayed graft function following renal transplantation.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23317546 2013 Overexpression of aminoacylase 1 is associated with colorectal cancer progression.
22905912 2012 Resveratrol-induced changes of the human adipocyte secretion profile.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21414403 2011 The molecular basis of aminoacylase 1 deficiency.
More...