Property Summary

NCBI Gene PubMed Count 729
Grant Count 880
R01 Count 621
Funding $80,521,678.92
PubMed Score 2274.01
PubTator Score 2416.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (63)

Disease Z-score Confidence
Cancer 2,346 5.338 2.7
Hypertension 287 4.021 2.0
Atherosclerosis 275 3.832 1.9
Lipodystrophy 32 3.507 1.8
Glaucoma 134 3.411 1.7
Lung disease 132 3.373 1.7
diabetes mellitus 1,663 3.132 1.6
Heart disease 279 3.0 1.5
Amyotrophic Lateral Sclerosis 431
Atrial Fibrillation 110
Breast cancer 3,094
Cardiomegaly 66
Congenital generalized lipodystrophy 7 4.0
Diabetes Mellitus, Experimental 106
Down syndrome 548
Duchenne muscular dystrophy 602
Electrocardiogram: P-R interval 9
Familial partial lipodystrophy 7
Glaucoma, Open-Angle 4
Heart conduction disease 65 2.0
Hypertensive disease 193
Lipoatrophic Diabetes Mellitus 5
Lipodystrophy with Congenital Cataracts ... 1 
Lipodystrophy, Congenital Generalized, T... 1 
Mammary Neoplasms 410
Neoplasm Metastasis 138
PULMONARY HYPERTENSION, PRIMARY, 3 1
Prostatic Neoplasms 471
Stevens-Johnson syndrome 78
Stomach Neoplasms 282
Weight Gain 87
X-linked cerebral adrenoleukodystrophy 115
autosomal dominant Emery-Dreifuss muscul... 499 
breast carcinoma 1,614
colon cancer 1,475
dermatomyositis 933
ductal carcinoma in situ 1,745
fibroadenoma 557
glioblastoma 5,572
group 3 medulloblastoma 2,254
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
juvenile dermatomyositis 1,189
lung adenocarcinoma 2,713
lung cancer 4,466
lung carcinoma 2,844
medulloblastoma, large-cell 6,234
nasopharyngeal carcinoma 1,056
non-small cell lung cancer 2,798
ovarian cancer 8,484
ovarian neoplasm 97
pancreatic cancer 2,300
pancreatic carcinoma 567
pediatric high grade glioma 2,712
pilocytic astrocytoma 3,086
posterior fossa group A ependymoma 1,511
primary pancreatic ductal adenocarcinoma 1,271
psoriasis 6,685
tuberculosis and treatment for 3 months 327
ulcerative colitis 2,087
urothelial carcinoma 318

Expression

Synonym

Accession Q03135 Q9UGP1 Q9UNG1 Q9UQH6
Symbols CGL3
PPH3
BSCL3
LCCNS
VIP21
MSTP085

Gene

Gene RIF (633)

PMID Text
27094744 Hypoxic down-regulation of constitutive endocytosis is HIF-independent, and involves caveolin-1-mediated inhibition of dynamin-dependent, membrane raft endocytosis.
26876307 Data show that loss of epithelial membrane protein 2 (EMP2) is involved in sphingosylphosphorylcholine (SPC)-induced phosphorylation of keratin 8 (K8) via ubiquitination of protein phosphatase 2 (PP2A) through alpha4 phosphoprotein by caveolin-1 (cav-1).
26837700 Cav-1 has a novel role in TCR/Lck spatial distribution upon TCR triggering, which controls T-cell fate toward a regulatory phenotype
26828798 Decreased caveolin-1 expression is associated with increased expression and phosphorylation levels of eNOS in endothelial cells stimulated by microgravity, which causes a dissociation of eNOS from caveolin-1 complexes.
26797118 Ankrd13 proteins cooperate with VCP to regulate the lysosomal trafficking of ubiquitinated Cav-1.
26794448 data provides novel insight into the regulation of CAV1 gene by histone H3 modifications and enhance the amplitude of the cancer epigenome
26725982 This study reports an unanticipated function of ROR1 as a scaffold of cavin-1 and caveolin-1, two essential structural components of caveolae.
26717806 Cav-1 may regulate the hepatocyte-like differentiation of human adipose-derived stem cellsby modulating mitogen-activated protein kinase kinase/MAPK signaling.
26626726 hypothesize that focal adhesion signaling pathways such as PI3K/Akt signaling may be negatively regulated by Cav-1 during mesenchymal stem cell osteogenesis
26615831 Study elucidated the relationship between TLR5 and caveolin-1 at the transcriptional and translational levels using human cells, results suggest that caveolin-1 is a crucial regulator for maintaining and controlling TLR5 expression.
More...

AA Sequence

MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFED      1 - 70
VIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIE     71 - 140
IQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI                                    141 - 178
//

Text Mined References (738)

PMID Year Title
27094744 2016 Hypoxia regulates global membrane protein endocytosis through caveolin-1 in cancer cells.
26876307 2016 Epithelial membrane protein 2 regulates sphingosylphosphorylcholine-induced keratin 8 phosphorylation and reorganization: Changes of PP2A expression by interaction with alpha4 and caveolin-1 in lung cancer cells.
26837700 2016 Caveolin-1 regulates TCR signal strength and regulatory T-cell differentiation into alloreactive T cells.
26828798 2016 The Impact of Simulated Weightlessness on Endothelium-Dependent Angiogenesis and the Role of Caveolae/Caveolin-1.
26797118 2016 The Ankrd13 Family of Ubiquitin-interacting Motif-bearing Proteins Regulates Valosin-containing Protein/p97 Protein-mediated Lysosomal Trafficking of Caveolin 1.
26794448 2016 Epigenetic drift towards histone modifications regulates CAV1 gene expression in colon cancer.
26725982 2016 ROR1 sustains caveolae and survival signalling as a scaffold of cavin-1 and caveolin-1.
26717806 2016 Caveolin-1 is essential in the differentiation of human adipose-derived stem cells into hepatocyte-like cells via an MAPK pathway-dependent mechanism.
26626726 2015 Promotion of human mesenchymal stem cell osteogenesis by PI3-kinase/Akt signaling, and the influence of caveolin-1/cholesterol homeostasis.
26615831 2015 Direct Regulation of TLR5 Expression by Caveolin-1.
More...