Property Summary

NCBI Gene PubMed Count 729
PubMed Score 2274.01
PubTator Score 2416.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
non-small cell lung cancer 2798 5.77497561344164E-28
lung carcinoma 2844 4.89567770306402E-25
lung adenocarcinoma 2714 1.38773312405976E-15
Breast cancer 3099 2.01501414678851E-13
ovarian cancer 8492 9.38926127494157E-11
pilocytic astrocytoma 3086 4.74091525597183E-9
posterior fossa group A ependymoma 1511 6.04036422316888E-9
lung cancer 4473 8.62817449013865E-8
juvenile dermatomyositis 1189 1.22409622722545E-7
Duchenne muscular dystrophy 602 7.10518762480167E-6
intraductal papillary-mucinous carcinoma (IPMC) 2988 9.54949646135979E-6
tuberculosis and treatment for 3 months 327 1.1274833977412E-5
ulcerative colitis 2087 2.65960889858048E-5
invasive ductal carcinoma 2950 2.92654824987106E-5
pediatric high grade glioma 2712 4.23560304343636E-5
ductal carcinoma in situ 1745 5.93684554757695E-5
breast carcinoma 1614 6.3776954998372E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 8.67316932805636E-5
primary pancreatic ductal adenocarcinoma 1271 1.12257490680764E-4
Amyotrophic Lateral Sclerosis 432 1.38249399145277E-4
colon cancer 1475 5.2740254119869E-4
nasopharyngeal carcinoma 1056 6.3863136611001E-4
psoriasis 6685 0.00189381700675524
medulloblastoma, large-cell 6234 0.00285348027590833
Down syndrome 548 0.00355105307591917
glioblastoma 5572 0.00499620540468157
group 3 medulloblastoma 2254 0.00805044889995891
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.01483550673302
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0155785617482671
dermatomyositis 967 0.0235256881352148
fibroadenoma 557 0.0262738145247035
urothelial carcinoma 318 0.0364484962601262
pancreatic cancer 2300 0.039066548663075
pancreatic carcinoma 567 0.039066548663075
X-linked cerebral adrenoleukodystrophy 115 0.0416426966623319
Disease Target Count Z-score Confidence
Glaucoma 135 3.411 1.7
Heart conduction disease 65 0.0 2.0

Expression

Synonym

Accession Q03135 Q9UGP1 Q9UNG1 Q9UQH6
Symbols CGL3
PPH3
BSCL3
LCCNS
VIP21
MSTP085

Gene

  Ortholog (10)

Gene RIF (631)

PMID Text
27094744 Hypoxic down-regulation of constitutive endocytosis is HIF-independent, and involves caveolin-1-mediated inhibition of dynamin-dependent, membrane raft endocytosis.
26876307 Data show that loss of epithelial membrane protein 2 (EMP2) is involved in sphingosylphosphorylcholine (SPC)-induced phosphorylation of keratin 8 (K8) via ubiquitination of protein phosphatase 2 (PP2A) through alpha4 phosphoprotein by caveolin-1 (cav-1).
26837700 Cav-1 has a novel role in TCR/Lck spatial distribution upon TCR triggering, which controls T-cell fate toward a regulatory phenotype
26828798 Decreased caveolin-1 expression is associated with increased expression and phosphorylation levels of eNOS in endothelial cells stimulated by microgravity, which causes a dissociation of eNOS from caveolin-1 complexes.
26797118 Ankrd13 proteins cooperate with VCP to regulate the lysosomal trafficking of ubiquitinated Cav-1.
26794448 data provides novel insight into the regulation of CAV1 gene by histone H3 modifications and enhance the amplitude of the cancer epigenome
26725982 This study reports an unanticipated function of ROR1 as a scaffold of cavin-1 and caveolin-1, two essential structural components of caveolae.
26717806 Cav-1 may regulate the hepatocyte-like differentiation of human adipose-derived stem cellsby modulating mitogen-activated protein kinase kinase/MAPK signaling.
26626726 hypothesize that focal adhesion signaling pathways such as PI3K/Akt signaling may be negatively regulated by Cav-1 during mesenchymal stem cell osteogenesis
26615831 Study elucidated the relationship between TLR5 and caveolin-1 at the transcriptional and translational levels using human cells, results suggest that caveolin-1 is a crucial regulator for maintaining and controlling TLR5 expression.
More...

AA Sequence

MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFED      1 - 70
VIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIE     71 - 140
IQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI                                    141 - 178
//

Text Mined References (738)

PMID Year Title
27094744 2016 Hypoxia regulates global membrane protein endocytosis through caveolin-1 in cancer cells.
26876307 2016 Epithelial membrane protein 2 regulates sphingosylphosphorylcholine-induced keratin 8 phosphorylation and reorganization: Changes of PP2A expression by interaction with alpha4 and caveolin-1 in lung cancer cells.
26837700 2016 Caveolin-1 regulates TCR signal strength and regulatory T-cell differentiation into alloreactive T cells.
26828798 2016 The Impact of Simulated Weightlessness on Endothelium-Dependent Angiogenesis and the Role of Caveolae/Caveolin-1.
26797118 2016 The Ankrd13 Family of Ubiquitin-interacting Motif-bearing Proteins Regulates Valosin-containing Protein/p97 Protein-mediated Lysosomal Trafficking of Caveolin 1.
26794448 2016 Epigenetic drift towards histone modifications regulates CAV1 gene expression in colon cancer.
26725982 2016 ROR1 sustains caveolae and survival signalling as a scaffold of cavin-1 and caveolin-1.
26717806 2016 Caveolin-1 is essential in the differentiation of human adipose-derived stem cells into hepatocyte-like cells via an MAPK pathway-dependent mechanism.
26626726 2015 Promotion of human mesenchymal stem cell osteogenesis by PI3-kinase/Akt signaling, and the influence of caveolin-1/cholesterol homeostasis.
26615831 2015 Direct Regulation of TLR5 Expression by Caveolin-1.
More...