Property Summary

NCBI Gene PubMed Count 84
Grant Count 44
R01 Count 10
Funding $7,926,790.25
PubMed Score 8.08
PubTator Score 71.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.764 0.000
medulloblastoma, large-cell -1.300 0.000
tuberculosis -1.300 0.000
Polycystic Ovary Syndrome -1.043 0.002

Gene RIF (50)

PMID Text
26767593 preeclampsia is associated with decreased methylation of the GNA12 promoter
26632408 we conclude that Galpha12 protects HUVECs[ human umbilical vein endothelial cells ] from serum withdrawal-induced apoptosis by retaining miR-155 expression.
26323264 RGS22 acts as a tumor suppressor, repressing human pancreatic adenocarcinoma cell migration by coupling to GNA12/13.
26100877 Data show that N-linked glycosylation of protease-activated receptor-1 (PAR1) at extracellular loop 2 (ECL2) controls G12/13 versus Gq G-proteins coupling specificity in response to thrombin stimulation.
25065598 Significance of Galpha12 upregulation in liver tumor progression, implicating Galpha12 as an attractive therapeutic target.
24704835 Results show that RMP serves as a potent factor contributing to portal vein tumor thrombus by promoting IL-6 transcription.
24631529 Galpha12gep oncogene inhibits FOXO1, which may result from the inhibition of FOXO1 de novo synthesis by miR-135b in conjunction with MDM2-mediated destabilization of FOXO1.
24464644 A tyrosine residue at the C-terminus of the Galpha subunit plays an important role in controlling activation of G-protein coupled receptors.
24055910 CREB is a critical signaling node in Lysophosphatidic acid-Lysophosphatidic acid receptor and Galpha12/gep proto-oncogene stimulated oncogenic signaling in ovarian cancer cells.
23762476 Galpha12 drives oral squamous cell carcinoma invasion through the up-regulation of IL-6 and IL-8 cytokines.
More...

AA Sequence

MSGVVRTLSRCLLPAEAGGARERRAGSGARDAEREARRRSRDIDALLARERRAVRRLVKILLLGAGESGK      1 - 70
STFLKQMRIIHGREFDQKALLEFRDTIFDNILKGSRVLVDARDKLGIPWQYSENEKHGMFLMAFENKAGL     71 - 140
PVEPATFQLYVPALSALWRDSGIREAFSRRSEFQLGESVKYFLDNLDRIGQLNYFPSKQDILLARKATKG    141 - 210
IVEHDFVIKKIPFKMVDVGGQRSQRQKWFQCFDGITSILFMVSSSEYDQVLMEDRRTNRLVESMNIFETI    211 - 280
VNNKLFFNVSIILFLNKMDLLVEKVKTVSIKKHFPDFRGDPHRLEDVQRYLVQCFDRKRRNRSKPLFHHF    281 - 350
TTAIDTENVRFVFHAVKDTILQENLKDIMLQ                                           351 - 381
//

Text Mined References (86)

PMID Year Title
26767593 2016 Preeclampsia is Associated with Decreased Methylation of the GNA12 Promoter.
26632408 2016 Galpha12 Protects Vascular Endothelial Cells from Serum Withdrawal-Induced Apoptosis through Regulation of miR-155.
26323264 2015 RGS22 inhibits pancreatic adenocarcinoma cell migration through the G12/13 ? subunit/F-actin pathway.
26100877 2015 N-linked glycosylation of protease-activated receptor-1 at extracellular loop 2 regulates G-protein signaling bias.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25065598 2015 G?12 gep oncogene deregulation of p53-responsive microRNAs promotes epithelial-mesenchymal transition of hepatocellular carcinoma.
24704835 2015 RMP promotes venous metastases of hepatocellular carcinoma through promoting IL-6 transcription.
24631529 2014 G?12gep oncogene inhibits FOXO1 in hepatocellular carcinoma as a consequence of miR-135b and miR-194 dysregulation.
24464644 2014 A yeast screening method to decipher the interaction between the adenosine A2B receptor and the C-terminus of different G protein ?-subunits.
24055910 2014 The gep proto-oncogene G?12 mediates LPA-stimulated activation of CREB in ovarian cancer cells.
More...