Property Summary

NCBI Gene PubMed Count 136
PubMed Score 124.52
PubTator Score 231.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.2
Kidney cancer 2613 0.0 0.6
Melanoma 711 0.0 0.8
Skin cancer 469 0.0 0.8
Disease Target Count Z-score Confidence
Osteoporosis 363 0.0 3.0
Disease Target Count Z-score Confidence
Cancer 2499 0.0 4.0
Disease Target Count Z-score Confidence
Leukemia 104 4.972 2.5
Gamma chain deficiency 7 3.079 1.5

Expression

  Differential Expression (29)

Disease log2 FC p
acute myeloid leukemia -2.300 4.2e-02
adrenocortical carcinoma 1.139 7.3e-04
Barrett's esophagus 1.200 2.0e-02
Breast cancer 1.400 3.3e-02
chronic rhinosinusitis -1.046 5.3e-03
cystic fibrosis 1.443 2.7e-06
dermatomyositis 1.100 7.8e-03
ductal carcinoma in situ -1.400 1.5e-03
ependymoma 2.800 1.3e-02
esophageal adenocarcinoma 1.800 1.8e-02
facioscapulohumeral dystrophy -1.200 2.1e-02
glioblastoma 1.300 3.3e-03
interstitial cystitis -1.200 1.5e-03
intraductal papillary-mucinous adenoma (... 2.200 1.2e-05
intraductal papillary-mucinous carcinoma... 1.400 1.5e-03
intraductal papillary-mucinous neoplasm ... 1.300 4.4e-03
invasive ductal carcinoma -2.000 1.0e-03
lung adenocarcinoma -1.300 1.5e-09
lung cancer -2.700 4.0e-04
lung carcinoma -1.200 4.3e-13
malignant mesothelioma -2.700 1.3e-06
medulloblastoma, large-cell -1.200 3.7e-02
osteosarcoma 2.231 1.1e-03
ovarian cancer 4.800 9.0e-12
pediatric high grade glioma 1.100 9.9e-03
Pick disease 1.200 2.8e-02
primitive neuroectodermal tumor 1.100 4.1e-02
psoriasis 1.200 8.3e-04
spina bifida -1.073 3.0e-02

Gene RIF (108)

AA Sequence

MKSEDYPHETMAPDIHEERQYRCEDCDQLFESKAELADHQKFPCSTPHSAFSMVEEDFQQKLESENDLQE      1 - 70
IHTIQECKECDQVFPDLQSLEKHMLSHTEEREYKCDQCPKAFNWKSNLIRHQMSHDSGKHYECENCAKVF     71 - 140
TDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQHKHIHSSVKPFICEVCHKSYTQFSNLCRHKRMH    141 - 210
ADCRTQIKCKDCGQMFSTTSSLNKHRRFCEGKNHFAAGGFFGQGISLPGTPAMDKTSMVNMSHANPGLAD    211 - 280
YFGANRHPAGLTFPTAPGFSFSFPGLFPSGLYHRPPLIPASSPVKGLSSTEQTNKSQSPLMTHPQILPAT    281 - 350
QDILKALSKHPSVGDNKPVELQPERSSEERPFEKISDQSESSDLDDVSTPSGSDLETTSGSDLESDIESD    351 - 420
KEKFKENGKMFKDKVSPLQNLASINNKKEYSNHSIFSPSLEEQTAVSGAVNDSIKAIASIAEKYFGSTGL    421 - 490
VGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRSLPLKMEPQSPGEVKKLQKGSSESPFDLTTKR    491 - 560
KDEKPLTPVPSKPPVTPATSQDQPLDLSMGSRSRASGTKLTEPRKNHVFGGKKGSNVESRPASDGSLQHA    561 - 630
RPTPFFMDPIYRVEKRKLTDPLEALKEKYLRPSPGFLFHPQFQLPDQRTWMSAIENMAEKLESFSALKPE    631 - 700
ASELLQSVPSMFNFRAPPNALPENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSF    701 - 770
SISSNLQRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSELESTGAILDDKE    771 - 840
DAYFTEIRNFIGNSNHGSQSPRNVEERMNGSHFKDEKALVTSQNSDLLDDEEVEDEVLLDEEDEDNDITG    841 - 910
KTGKEPVTSNLHEGNPEDDYEETSALEMSCKTSPVRYKEEEYKSGLSALDHIRHFTDSLKMRKMEDNQYS    911 - 980
EAELSSFSTSHVPEELKQPLHRKSKSQAYAMMLSLSDKESLHSTSHSSSNVWHSMARAAAESSAIQSISH    981 - 1050
V//

Text Mined References (147)

PMID Year Title