Property Summary

NCBI Gene PubMed Count 25
Grant Count 50
R01 Count 26
Funding $5,565,433.44
PubMed Score 283.07
PubTator Score 119.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
posterior fossa group B ependymoma 1.900 0.000
adult high grade glioma -1.200 0.002

 GO Function (1)

Gene RIF (21)

PMID Text
26635203 Recurrent mutations within Wilms tumours involve the highly conserved YEATS domain of MLLT1.
25921070 Data suggest that AT mutated protein ATM-dependent phosphorylation of ENL (MLLT1) protein functions as switch from elongation to Polycomb-mediated repression to preserve genome integrity.
25509985 AF9 and its homolog ENL directly interact with AF4.
25481096 Novel splice isoform of Mllt1 is documented and confirmed that both Mllt1 mRNA isoforms are translated. The data support that MLLT1 protein isoforms display distinct stage-specific expression during spermiogenesis and adult tissues.
24367103 Binding of isolated AFF1(1-308) CBS to CDK9/CycT1 prevents HIV-1 Tat from activating HIV transcription and assembling complete SECs (AFF1, AFF4, ELL2, and ENL). The AFF1(1-308) M60A/L61A mutant shows no suppression of Tat transactivation
23623499 MLL-ENL Interaction with CBX8 Is Required for Efficient Transformation.
23518577 Binding of isolated AFF1(1-308) CBS to CDK9/CycT1 prevents HIV-1 Tat from activating HIV transcription and assembling complete SECs (AFF1, AFF4, ELL2, and ENL). The AFF1(1-308) M60A/L61A mutant shows no suppression of Tat transactivation
23518577 Binding of isolated AFF1(1-308) CBS to CDK9/CycT1 prevents HIV-1 Tat from activating HIV transcription and assembling complete SECs (AFF1, AFF4, ELL2, and ENL). The AFF1(1-308) M60A/L61A mutant shows no suppression of Tat transactivation
23251033 Binding of isolated AFF1(1-308) CBS to CDK9/CycT1 prevents HIV-1 Tat from activating HIV transcription and assembling complete SECs (AFF1, AFF4, ELL2, and ENL). The AFF1(1-308) M60A/L61A mutant shows no suppression of Tat transactivation
22567366 Binding of isolated AFF1(1-308) CBS to CDK9/CycT1 prevents HIV-1 Tat from activating HIV transcription and assembling complete SECs (AFF1, AFF4, ELL2, and ENL). The AFF1(1-308) M60A/L61A mutant shows no suppression of Tat transactivation
More...

AA Sequence

MDNQCTVQVRLELGHRAQLRKKPTTEGFTHDWMVFVRGPEQCDIQHFVEKVVFWLHDSFPKPRRVCKEPP      1 - 70
YKVEESGYAGFIMPIEVHFKNKEEPRKVCFTYDLFLNLEGNPPVNHLRCEKLTFNNPTTEFRYKLLRAGG     71 - 140
VMVMPEGADTVSRPSPDYPMLPTIPLSAFSDPKKTKPSHGSKDANKESSKTSKPHKVTKEHRERPRKDSE    141 - 210
SKSSSKELEREQAKSSKDTSRKLGEGRLPKEEKAPPPKAAFKEPKMALKETKLESTSPKGGPPPPPPPPP    211 - 280
RASSKRPATADSPKPSAKKQKKSSSKGSRSAPGTSPRTSSSSSFSDKKPAKDKSSTRGEKVKAESEPREA    281 - 350
KKALEVEESNSEDEASFKSESAQSSPSNSSSSSDSSSDSDFEPSQNHSQGPLRSMVEDLQSEESDEDDSS    351 - 420
SGEEAAGKTNPGRDSRLSFSDSESDNSADSSLPSREPPPPQKPPPPNSKVSGRRSPESCSKPEKILKKGT    421 - 490
YDKAYTDELVELHRRLMALRERNVLQQIVNLIEETGHFNVTNTTFDFDLFSLDETTVRKLQSCLEAVAT     491 - 559
//

Text Mined References (35)

PMID Year Title
26635203 2015 MLLT1 YEATS domain mutations in clinically distinctive Favourable Histology Wilms tumours.
25921070 2015 Transcriptional elongation factor ENL phosphorylated by ATM recruits polycomb and switches off transcription for DSB repair.
25509985 2014 An AF9/ENL-targted peptide with therapeutic potential in mixed lineage leukemias.
25481096 2015 Identification of a novel isoform of the leukemia-associated MLLT1 (ENL/LTG19) protein.
23623499 2013 MLL-ENL inhibits polycomb repressive complex 1 to achieve efficient transformation of hematopoietic cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23145062 2012 Human ALKBH4 interacts with proteins associated with transcription.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22195968 2011 The little elongation complex regulates small nuclear RNA transcription.
21953510 2011 Clinical outcome and monitoring of minimal residual disease in patients with acute lymphoblastic leukemia expressing the MLL/ENL fusion gene.
More...