Property Summary

NCBI Gene PubMed Count 27
PubMed Score 301.22
PubTator Score 119.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Wilms Tumor 28 0.0 0.0
Disease Target Count P-value
ependymoma 4679 1.2e-04
adult high grade glioma 3801 2.2e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Cancer 2499 4.08 2.0
Disease Target Count Z-score Confidence
Leprosy 73 6.736 3.4
Neuritis 5 4.148 2.1

Expression

  Differential Expression (2)

Disease log2 FC p
adult high grade glioma -1.200 2.2e-03
ependymoma 1.600 1.2e-04

 GO Function (1)

Gene RIF (22)

AA Sequence

MDNQCTVQVRLELGHRAQLRKKPTTEGFTHDWMVFVRGPEQCDIQHFVEKVVFWLHDSFPKPRRVCKEPP      1 - 70
YKVEESGYAGFIMPIEVHFKNKEEPRKVCFTYDLFLNLEGNPPVNHLRCEKLTFNNPTTEFRYKLLRAGG     71 - 140
VMVMPEGADTVSRPSPDYPMLPTIPLSAFSDPKKTKPSHGSKDANKESSKTSKPHKVTKEHRERPRKDSE    141 - 210
SKSSSKELEREQAKSSKDTSRKLGEGRLPKEEKAPPPKAAFKEPKMALKETKLESTSPKGGPPPPPPPPP    211 - 280
RASSKRPATADSPKPSAKKQKKSSSKGSRSAPGTSPRTSSSSSFSDKKPAKDKSSTRGEKVKAESEPREA    281 - 350
KKALEVEESNSEDEASFKSESAQSSPSNSSSSSDSSSDSDFEPSQNHSQGPLRSMVEDLQSEESDEDDSS    351 - 420
SGEEAAGKTNPGRDSRLSFSDSESDNSADSSLPSREPPPPQKPPPPNSKVSGRRSPESCSKPEKILKKGT    421 - 490
YDKAYTDELVELHRRLMALRERNVLQQIVNLIEETGHFNVTNTTFDFDLFSLDETTVRKLQSCLEAVAT     491 - 559
//

Text Mined References (38)

PMID Year Title