Property Summary

NCBI Gene PubMed Count 21
PubMed Score 180.09
PubTator Score 135.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 1.16124309962599E-8
ovarian cancer 8492 2.90881895087954E-8
psoriasis 6685 1.30410000197448E-4
group 4 medulloblastoma 1875 1.59666055528899E-4
medulloblastoma, large-cell 6234 0.00161246345921618
cutaneous lupus erythematosus 1056 0.00802865239079522
Disease Target Count Z-score Confidence
Rheumatoid Arthritis 1171 0.0 5.0

Expression

  Differential Expression (6)

Disease log2 FC p
cutaneous lupus erythematosus -1.400 0.008
psoriasis -2.600 0.000
group 4 medulloblastoma -1.200 0.000
medulloblastoma, large-cell 1.200 0.002
posterior fossa group A ependymoma -1.100 0.000
ovarian cancer 1.300 0.000

Synonym

Accession Q03052 Q5TAG2
Symbols OCT6
OTF6
SCIP

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Xenopus OMA Inparanoid

Gene RIF (4)

PMID Text
24671357 Combined high OATP1A2/high OCT6 may be a potential predictor of response to anthracycline/taxane-based chemotherapy in breast cancer
21448695 CpG island hypermethylation contributes to down-regulation of Oct-6 mRNA expression in hepatocellular carcinoma.
17959798 Strict control of Pou3f1 transgene expression is critical to proper myelination, and factors responsible for Pouf31 downregulation during myelination may play important roles in the development of peripheral neuropathies.
17195013 Our results suggest that Tst-1 and Skn-1a regulate expression of MMPs in keratinocytes and effect both the expression and activation of these proteolytic enzymes.

AA Sequence

MATTAQYLPRGPGGGAGGTGPLMHPDAAAAAAAAAAAERLHAGAAYREVQKLMHHEWLGAGAGHPVGLAH      1 - 70
PQWLPTGGGGGGDWAGGPHLEHGKAGGGGTGRADDGGGGGGFHARLVHQGAAHAGAAWAQGSTAHHLGPA     71 - 140
MSPSPGASGGHQPQPLGLYAQAAYPGGGGGGLAGMLAAGGGGAGPGLHHALHEDGHEAQLEPSPPPHLGA    141 - 210
HGHAHGHAHAGGLHAAAAHLHPGAGGGGSSVGEHSDEDAPSSDDLEQFAKQFKQRRIKLGFTQADVGLAL    211 - 280
GTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEETDSSSGSPTNLDKIAAQGRKRKKRTSIEVGV    281 - 350
KGALESHFLKCPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKRMTPAAGAGHPPMDDVYAPGELGPG    351 - 420
GGGASPPSAPPPPPPAALHHHHHHTLPGSVQ                                           421 - 451
//

Text Mined References (22)

PMID Year Title
24671357 2014 Expression of organic anion-transporting polypeptide 1A2 and organic cation transporter 6 as a predictor of pathologic response to neoadjuvant chemotherapy in triple negative breast cancer.
23192594 2013 Gene-environment interactions and obesity traits among postmenopausal African-American and Hispanic women in the Women's Health Initiative SHARe Study.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
21448695 2011 Aberrant CpG island hypermethylation and down-regulation of Oct-6 mRNA expression in human hepatocellular carcinoma.
20453842 2010 Genome-wide association study meta-analysis identifies seven new rheumatoid arthritis risk loci.
17959798 2007 Misexpression of Pou3f1 results in peripheral nerve hypomyelination and axonal loss.
17195013 2007 Matrix metalloproteinase-19 expression in keratinocytes is repressed by transcription factors Tst-1 and Skn-1a: implications for keratinocyte differentiation.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
12557005 2003 Oct6, a transcription factor controlling myelination, is a marker for active nerve regeneration in peripheral neuropathies.
9742157 1998 Promyelinating Schwann cells express Tst-1/SCIP/Oct-6.
More...