Property Summary

NCBI Gene PubMed Count 21
PubMed Score 190.50
PubTator Score 135.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
cutaneous lupus erythematosus -1.400 8.0e-03
group 4 medulloblastoma -1.200 1.6e-04
medulloblastoma, large-cell 1.200 1.6e-03
ovarian cancer 1.300 2.9e-08
posterior fossa group A ependymoma -1.100 1.2e-08
psoriasis 2.500 2.1e-05

Synonym

Accession Q03052 Q5TAG2
Symbols OCT6
OTF6
SCIP

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

AA Sequence

MATTAQYLPRGPGGGAGGTGPLMHPDAAAAAAAAAAAERLHAGAAYREVQKLMHHEWLGAGAGHPVGLAH      1 - 70
PQWLPTGGGGGGDWAGGPHLEHGKAGGGGTGRADDGGGGGGFHARLVHQGAAHAGAAWAQGSTAHHLGPA     71 - 140
MSPSPGASGGHQPQPLGLYAQAAYPGGGGGGLAGMLAAGGGGAGPGLHHALHEDGHEAQLEPSPPPHLGA    141 - 210
HGHAHGHAHAGGLHAAAAHLHPGAGGGGSSVGEHSDEDAPSSDDLEQFAKQFKQRRIKLGFTQADVGLAL    211 - 280
GTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEETDSSSGSPTNLDKIAAQGRKRKKRTSIEVGV    281 - 350
KGALESHFLKCPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKRMTPAAGAGHPPMDDVYAPGELGPG    351 - 420
GGGASPPSAPPPPPPAALHHHHHHTLPGSVQ                                           421 - 451
//

Text Mined References (22)

PMID Year Title