Property Summary

NCBI Gene PubMed Count 165
PubMed Score 1150.69
PubTator Score 509.20

Knowledge Summary

Patent

No data available

Expression

Gene RIF (160)

AA Sequence

MQYPHPGPAAGAVGVPLYAPTPLLQPAHPTPFYIEDILGRGPAAPTPAPTLPSPNSSFTSLVSPYRTPVY      1 - 70
EPTPIHPAFSHHSAAALAAAYGPGGFGGPLYPFPRTVNDYTHALLRHDPLGKPLLWSPFLQRPLHKRKGG     71 - 140
QVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRRLKQENPQSNKKEELES    141 - 210
LDSSCDQRQDLPSEQNKGASLDSSQCSPSPASQEDLESEISEDSDQEVDIEGDKSYFNAG              211 - 270
//

Text Mined References (168)

PMID Year Title