Property Summary

NCBI Gene PubMed Count 157
Grant Count 116
R01 Count 69
Funding $16,721,243.38
PubMed Score 1034.49
PubTator Score 509.20

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q03014 B1AQ17 Q96CE9 Homeobox protein HEX
Symbols HEX
PRH
HMPH
PRHX
HOX11L-PEN

Gene

PDB

2E1O  

Gene RIF (152)

PMID Text
27052408 Data suggest that hematopoietically expressed homeobox protein (HHEX) downmodulation by promyelocytic leukemia-retinoic acid receptor alpha fusion oncoprotein (PML-RARalpha) is a key event during acute promyelocytic leukemia (APL) pathogenesis.
26728554 Hhex binds to the Cdkn2a locus and directly interacts with the Polycomb-repressive complex 2 (PRC2) to enable H3K27me3-mediated epigenetic repression
25220416 Data suggest that Hhex is a novel regulator of c-Myc function that limits c-Myc activity in transformed cells.
24651531 HHEX promotes hepatic specification by repressing EOMES expression.
24240683 PRH controls the migration of multiple epithelial cell lineages in part at least through the direct transcriptional regulation of Endoglin
24112421 Data indicate the potential importance of CDKAL1 protein and homeobox protein HHEX in glucose homeostasis in this Alaska Native population with a low prevalence of type 2 diabetes (T2D).
23929257 In all the CHD patients, we did not find any causative mutations in the coding region of the HHEX gene.
23445342 Tissue-specific knockdown of the HHEX ortholog dHHEX (CG7056) directed metabolic defects and enhanced lethality; for example, fat-body-specific loss of dHHEX led to increased hemolymph glucose and reduced insulin sensitivity
23349771 Data indicate associations of SNPs in eight loci CXCR4, HHEX, FOXA2, NGN3, TCF7L2, FLJ39370 (C4orf32), LOC646279 (RPL21P7) and THADA with body mass index (BMI) and weight.
23166797 A significant association of rs1111875, rs5015480 and rs7923837 in HHEX gene with type 2 diabetes.
More...

AA Sequence

MQYPHPGPAAGAVGVPLYAPTPLLQPAHPTPFYIEDILGRGPAAPTPAPTLPSPNSSFTSLVSPYRTPVY      1 - 70
EPTPIHPAFSHHSAAALAAAYGPGGFGGPLYPFPRTVNDYTHALLRHDPLGKPLLWSPFLQRPLHKRKGG     71 - 140
QVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRRLKQENPQSNKKEELES    141 - 210
LDSSCDQRQDLPSEQNKGASLDSSQCSPSPASQEDLESEISEDSDQEVDIEGDKSYFNAG              211 - 270
//

Text Mined References (160)

PMID Year Title
27052408 2016 PML-RAR alpha induces the downmodulation of HHEX: a key event responsible for the induction of an angiogenetic response.
26728554 2016 Acute myeloid leukemia requires Hhex to enable PRC2-mediated epigenetic repression of Cdkn2a.
25416956 2014 A proteome-scale map of the human interactome network.
25220416 2015 Growth-promoting and tumourigenic activity of c-Myc is suppressed by Hhex.
24651531 2014 HHEX promotes hepatic-lineage specification through the negative regulation of eomesodermin.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
24240683 2014 PRH/HHex inhibits the migration of breast and prostate epithelial cells through direct transcriptional regulation of Endoglin.
24112421 2014 CDKAL1 and HHEX are associated with type 2 diabetes-related traits among Yup'ik people.
23945395 2014 Genome-wide association study identifies three novel loci for type 2 diabetes.
23929257 2013 The HHEX gene is not related to congenital heart disease in 296 Chinese patients.
More...