Property Summary

NCBI Gene PubMed Count 36
PubMed Score 13.74
PubTator Score 20.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
cutaneous lupus erythematosus -1.200 0.017
psoriasis -1.700 0.000
group 3 medulloblastoma -1.400 0.000
cystic fibrosis -1.088 0.000
glioblastoma 1.100 0.002
ductal carcinoma in situ -1.100 0.012
pituitary cancer 1.200 0.000
dermatomyositis -1.400 0.001

Synonym

Accession Q03013 A8K765 Q05465 Q32NC1 Q4JNT8 Q6FH87
Symbols GTM4
GSTM4-4

Gene

PDB

4GTU  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
602391 confirmatory 5 / 23 / 28 qHTS Assay for Inhibitors of Bacillus subtilis Sfp phosphopantetheinyl transferase (PPTase): SAR in hGST A1-1

Gene RIF (22)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20529827 There were no significant associations between glutathione-S-transferases and p53 expressions and tumor stage, tumor grade and smoking status (p>0.05).
20485444 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20200426 We observed suggestive associations between survival and GSTT1 copy number and GSTA5, GSTM4, and ABCC4 single nucleotide polymorphisms
20200426 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19898482 Observational study of gene-disease association. (HuGE Navigator)
19856098 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19718047 GSTM4 contributes to the cancerous behavior of Ewing's sarcoma.
More...

AA Sequence

MSMTLGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKI      1 - 70
TQSNAILCYIARKHNLCGETEEEKIRVDILENQAMDVSNQLARVCYSPDFEKLKPEYLEELPTMMQHFSQ     71 - 140
FLGKRPWFVGDKITFVDFLAYDVLDLHRIFEPNCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPKPLYT    141 - 210
RVAVWGNK                                                                  211 - 218
//

Text Mined References (38)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20529827 2010 The expression of GST isoenzymes and p53 in non-small cell lung cancer.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20200426 2010 Glutathione pathway genetic polymorphisms and lung cancer survival after platinum-based chemotherapy.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19898482 2009 Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
19856098 2010 Genetic variants in GSTM3 gene within GSTM4-GSTM2-GSTM1-GSTM5-GSTM3 cluster influence breast cancer susceptibility depending on GSTM1.
19718047 2009 GSTM4 is a microsatellite-containing EWS/FLI target involved in Ewing's sarcoma oncogenesis and therapeutic resistance.
More...