Property Summary

NCBI Gene PubMed Count 37
PubMed Score 13.72
PubTator Score 20.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Neurodegenerative Disorders 79
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Tinea pedis 29 4.09 2.0

Expression

  Differential Expression (8)

Disease log2 FC p
cutaneous lupus erythematosus -1.200 1.7e-02
cystic fibrosis -1.088 8.2e-05
dermatomyositis -1.400 5.3e-04
ductal carcinoma in situ -1.100 1.2e-02
glioblastoma 1.100 2.0e-03
group 3 medulloblastoma -1.400 2.9e-04
pituitary cancer 1.200 1.4e-04
psoriasis -1.700 1.7e-04

 IMPC Phenotype (1)

Gene RIF (23)

AA Sequence

MSMTLGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKI      1 - 70
TQSNAILCYIARKHNLCGETEEEKIRVDILENQAMDVSNQLARVCYSPDFEKLKPEYLEELPTMMQHFSQ     71 - 140
FLGKRPWFVGDKITFVDFLAYDVLDLHRIFEPNCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPKPLYT    141 - 210
RVAVWGNK                                                                  211 - 218
//

Text Mined References (39)

PMID Year Title