Property Summary

NCBI Gene PubMed Count 22
Grant Count 5
R01 Count 4
Funding $435,686.2
PubMed Score 24.82
PubTator Score 25.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.300 0.031
psoriasis 1.700 0.001
osteosarcoma -2.049 0.000
juvenile dermatomyositis -1.181 0.000
pancreatic ductal adenocarcinoma liver m... -1.140 0.015
Pick disease -1.100 0.000
ovarian cancer 1.500 0.000

Gene RIF (13)

PMID Text
23266187 Compares and contrasts all the known human SLC25A* genes and includes functional information.
23125841 Tandem affinity purification and mass spectrometry analysis identify mitochondrial 2-oxoglutarate/malate carrier protein (SLC25A11), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify mitochondrial 2-oxoglutarate/malate carrier protein (SLC25A11), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify mitochondrial 2-oxoglutarate/malate carrier protein (SLC25A11), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify mitochondrial 2-oxoglutarate/malate carrier protein (SLC25A11), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23054077 OGC as a model protein for understanding the transport mechanism of mitochondrial carriers.
21500544 OGCP degrades through proteasome and lysosome degradation pathways. The degradation of parkin protein can promote the degradation of OGCP.
21448454 Controlling MISC-1/OGC function allows regulation of mitochondrial morphology and cell survival decisions by the metabolic needs of the cell.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MAATASAGAGGIDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTREYKTSFHALTS      1 - 70
ILKAEGLRGIYTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLLKAVIGMTAGATGAFVGTPA     71 - 140
EVALIRMTADGRLPADQRRGYKNVFNALIRITREEGVLTLWRGCIPTMARAVVVNAAQLASYSQSKQFLL    141 - 210
DSGYFSDNILCHFCASMISGLVTTAASMPVDIAKTRIQNMRMIDGKPEYKNGLDVLFKVVRYEGFFSLWK    211 - 280
GFTPYYARLGPHTVLTFIFLEQMNKAYKRLFLSG                                        281 - 314
//

Text Mined References (31)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23266187 The mitochondrial transporter family SLC25: identification, properties and physiopathology.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23054077 2013 The mitochondrial oxoglutarate carrier: from identification to mechanism.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21500544 2011 [Metabolic pathways of OGCP and the influence of parkin protein on the metabolism of OGCP].
More...