Property Summary

NCBI Gene PubMed Count 22
PubMed Score 27.90
PubTator Score 25.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.300 3.1e-02
juvenile dermatomyositis -1.181 3.5e-08
osteosarcoma -2.049 4.2e-07
ovarian cancer 1.500 2.8e-05
pancreatic ductal adenocarcinoma liver m... -1.038 1.4e-02
Pick disease -1.100 5.0e-05
psoriasis 1.700 1.4e-03

Protein-protein Interaction (10)

Gene RIF (10)

AA Sequence

MAATASAGAGGIDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTREYKTSFHALTS      1 - 70
ILKAEGLRGIYTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLLKAVIGMTAGATGAFVGTPA     71 - 140
EVALIRMTADGRLPADQRRGYKNVFNALIRITREEGVLTLWRGCIPTMARAVVVNAAQLASYSQSKQFLL    141 - 210
DSGYFSDNILCHFCASMISGLVTTAASMPVDIAKTRIQNMRMIDGKPEYKNGLDVLFKVVRYEGFFSLWK    211 - 280
GFTPYYARLGPHTVLTFIFLEQMNKAYKRLFLSG                                        281 - 314
//

Text Mined References (31)

PMID Year Title