Property Summary

NCBI Gene PubMed Count 139
Grant Count 193
R01 Count 134
Funding $17,088,595.93
PubMed Score 471.78
PubTator Score 322.16

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q02962 Q15105 Q15110 Q15837 Q5SZP2 Q5SZP3
Symbols FSGS7
PAPRS

Gene

 GWAS Trait (1)

Gene RIF (103)

PMID Text
27324546 PAX2 gene silencing can significantly inhibit the process of epithelial-mesenchymal transition (EMT) of renal tubular cells in rats with advanced fibrosis.
26823795 PAX2 and PAX5 are useful biomarker in the differential diagnosis of lung cancer
26571382 The results of this study identify several new mutations of PAX2, and sequence variants in four additional genes, including a novel potentially pathogenic mutation in KIF26B, which may play a role in the pathogenesis of Renal Coloboma Syndrome.
26404914 a substantial minority of solitary fibrous tumors express nuclear PAX8 and PAX2
25912758 Report increased Pax2 expression in the ureter epithelium of children with vesicoureteric reflux.
25854853 Homozygosity for the risk alleles of RET and PAX2 was not seen in the late onset group in primary hyperoxaluria type 1 patients.
25631048 PPM1B interacts with Groucho 4 and is localized to DNA in a Groucho-dependent manner, and phosphatase activity is required for transcriptional silencing.
25613757 Results showed that PAX2 expression is significantly overexpressed in esophageal squamous cell carcinoma tissues and IL-5 is identified as PAX2's effector for metastasis.
25500505 data suggested the differential regulation of hDAO expression by two promoters whose activities may be modulated by the binding of PAX2 and PAX5
25385517 The 798C>T/909A>C PAX2 genotype did not increase the susceptibility to HenochSchonlein purpura (HSP), but it was likely to increase the susceptibility of kidney involvement in HSP patients.
More...

AA Sequence

MDMHCKADPFSAMHPGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILG      1 - 70
RYYETGSIKPGVIGGSKPKVATPKVVDKIAEYKRQNPTMFAWEIRDRLLAEGICDNDTVPSVSSINRIIR     71 - 140
TKVQQPFHPTPDGAGTGVTAPGHTIVPSTASPPVSSASNDPVGSYSINGILGIPRSNGEKRKRDEVEVYT    141 - 210
DPAHIRGGGGLHLVWTLRDVSEGSVPNGDSQSGVDSLRKHLRADTFTQQQLEALDRVFERPSYPDVFQAS    211 - 280
EHIKSEQGNEYSLPALTPGLDEVKSSLSASTNPELGSNVSGTQTYPVVTGRDMASTTLPGYPPHVPPTGQ    281 - 350
GSYPTSTLAGMVPGSEFSGNPYSHPQYTAYNEAWRFSNPALLSSPYYYSAAPRGSAPAAAAAAYDRH       351 - 417
//

Text Mined References (141)

PMID Year Title
27324546 2016 [Influence of PAX2 gene silencing on renal interstitial fibrosis in rats].
26823795 2015 Diagnostic utility of PAX2 and PAX5 in distinguishing non-small cell lung cancer from small cell lung cancer.
26571382 2015 Association of PAX2 and Other Gene Mutations with the Clinical Manifestations of Renal Coloboma Syndrome.
26404914 2016 A subset of solitary fibrous tumors express nuclear PAX8 and PAX2: a potential diagnostic pitfall.
25912758 2015 The significance of Pax2 expression in the ureter epithelium of children with vesicoureteric reflux.
25854853 2015 SNP Variants in RET and PAX2 and Their Possible Contribution to the Primary Hyperoxaluria Type 1 Phenotype.
25631048 2015 The Groucho-associated phosphatase PPM1B displaces Pax transactivation domain interacting protein (PTIP) to switch the transcription factor Pax2 from a transcriptional activator to a repressor.
25613757 2015 Upregulation of PAX2 promotes the metastasis of esophageal cancer through interleukin-5.
25500505 2015 Identification of two promoters for human D-amino acid oxidase gene: implication for the differential promoter regulation mediated by PAX5/PAX2.
25385517 2015 Association of the paired box 2 gene polymorphism with the susceptibility and pathogenesis of Henoch?Schönlein purpura in children.
More...