Property Summary

NCBI Gene PubMed Count 72
PubMed Score 126.81
PubTator Score 67.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Breast Neoplasms 445 0.0 0.0
Disease Target Count
Mammary Neoplasms 425
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.8
Disease Target Count Z-score Confidence
Myasthenia gravis 23 3.375 1.7
Cancer 2499 3.363 1.7

Expression

  Differential Expression (34)

Disease log2 FC p
adrenocortical carcinoma -1.404 3.0e-02
astrocytic glioma -1.600 1.9e-02
Atopic dermatitis -1.800 9.3e-04
atypical teratoid / rhabdoid tumor -1.700 5.4e-03
autosomal dominant Emery-Dreifuss muscul... 1.167 8.9e-03
breast carcinoma -1.500 4.1e-04
chronic lymphosyte leukemia 1.200 2.9e-05
colon cancer -2.500 1.1e-02
cystic fibrosis 1.200 6.4e-03
Duchenne muscular dystrophy 1.103 9.7e-06
ductal carcinoma in situ -2.200 9.9e-04
ependymoma -2.400 1.4e-02
fibroadenoma -1.500 2.1e-02
gastric carcinoma 1.700 2.8e-02
Gaucher disease type 3 -1.100 7.8e-03
group 3 medulloblastoma -1.100 3.0e-02
interstitial cystitis -1.300 1.3e-02
intraductal papillary-mucinous adenoma (... -3.200 2.5e-04
intraductal papillary-mucinous carcinoma... -3.300 1.1e-03
intraductal papillary-mucinous neoplasm ... -2.100 3.4e-02
invasive ductal carcinoma -1.070 2.7e-02
lung adenocarcinoma -1.400 4.5e-10
lung cancer -2.600 2.1e-05
lung carcinoma -1.100 3.1e-05
medulloblastoma, large-cell -1.600 4.8e-02
non-small cell lung cancer -1.558 1.1e-09
oligodendroglioma -2.100 1.9e-02
ovarian cancer -2.400 6.9e-05
pancreatic cancer 2.400 6.5e-04
pituitary cancer -1.700 1.3e-02
primary pancreatic ductal adenocarcinoma 1.682 1.7e-03
psoriasis -1.200 4.9e-05
tuberculosis -3.900 1.1e-07
ulcerative colitis 1.100 1.1e-02

Gene RIF (53)

AA Sequence

MGAGSSTEQRSPEQPPEGSSTPAEPEPSGGGPSAEAAPDTTADPAIAASDPATKLLQKNGQLSTINGVAE      1 - 70
QDELSLQEGDLNGQKGALNGQGALNSQEEEEVIVTEVGQRDSEDVSKRDSDKEMATKSAVVHDITDDGQE     71 - 140
ETPEIIEQIPSSESNLEELTQPTESQANDIGFKKVFKFVGFKFTVKKDKTEKPDTVQLLTVKKDEGEGAA    141 - 210
GAGDHKDPSLGAGEAASKESEPKQSTEKPEETLKREQSHAEISPPAESGQAVEECKEEGEEKQEKEPSKS    211 - 280
AESPTSPVTSETGSTFKKFFTQGWAGWRKKTSFRKPKEDEVEASEKKKEQEPEKVDTEEDGKAEVASEKL    281 - 350
TASEQAHPQEPAESAHEPRLSAEYEKVELPSEEQVSGSQGPSEEKPAPLATEVFDEKIEVHQEEVVAEVH    351 - 420
VSTVEERTEEQKTEVEETAGSVPAEELVEMDAEPQEAEPAKELVKLKETCVSGEDPTQGADLSPDEKVLS    421 - 490
KPPEGVVSEVEMLSSQERMKVQGSPLKKLFTSTGLKKLSGKKQKGKRGGGDEESGEHTQVPADSPDSQEE    491 - 560
QKGESSASSPEEPEEITCLEKGLAEVQQDGEAEEGATSDGEKKREGVTPWASFKKMVTPKKRVRRPSESD    561 - 630
KEDELDKVKSATLSSTESTASEMQEEMKGSVEEPKPEEPKRKVDTSVSWEALICVGSSKKRARRGSSSDE    631 - 700
EGGPKAMGGDHQKADEAGKDKETGTDGILAGSQEHDPGQGSSSPEQAGSPTEGEGVSTWESFKRLVTPRK    701 - 770
KSKSKLEEKSEDSIAGSGVEHSTPDTEPGKEESWVSIKKFIPGRRKKRPDGKQEQAPVEDAGPTGANEDD    771 - 840
SDVPAVVPLSEYDAVEREKMEAQQAQKSAEQPEQKAATEVSKELSESQVHMMAAAVADGTRAATIIEERS    841 - 910
PSWISASVTEPLEQVEAEAALLTEEVLEREVIAEEEPPTVTEPLPENREARGDTVVSEAELTPEAVTAAE    911 - 980
TAGPLGAEEGTEASAAEETTEMVSAVSQLTDSPDTTEEATPVQEVEGGVPDIEEQERRTQEVLQAVAEKV    981 - 1050
KEESQLPGTGGPEDVLQPVQRAEAERPEEQAEASGLKKETDVVLKVDAQEAKTEPFTQGKVVGQTTPESF   1051 - 1120
EKAPQVTESIESSELVTTCQAETLAGVKSQEMVMEQAIPPDSVETPTDSETDGSTPVADFDAPGTTQKDE   1121 - 1190
IVEIHEENEVASGTQSGGTEAEAVPAQKERPPAPSSFVFQEETKEQSKMEDTLEHTDKEVSVETVSILSK   1191 - 1260
TEGTQEADQYADEKTKDVPFFEGLEGSIDTGITVSREKVTEVALKGEGTEEAECKKDDALELQSHAKSPP   1261 - 1330
SPVEREMVVQVEREKTEAEPTHVNEEKLEHETAVTVSEEVSKQLLQTVNVPIIDGAKEVSSLEGSPPPCL   1331 - 1400
GQEEAVCTKIQVQSSEASFTLTAAAEEEKVLGETANILETGETLEPAGAHLVLEEKSSEKNEDFAAHPGE   1401 - 1470
DAVPTGPDCQAKSTPVIVSATTKKGLSSDLEGEKTTSLKWKSDEVDEQVACQEVKVSVAIEDLEPENGIL   1471 - 1540
ELETKSSKLVQNIIQTAVDQFVRTEETATEMLTSELQTQAHVIKADSQDAGQETEKEGEEPQASAQDETP   1541 - 1610
ITSAKEESESTAVGQAHSDISKDMSEASEKTMTVEVEGSTVNDQQLEEVVLPSEEEGGGAGTKSVPEDDG   1611 - 1680
HALLAERIEKSLVEPKEDEKGDDVDDPENQNSALADTDASGGLTKESPDTNGPKQKEKEDAQEVELQEGK   1681 - 1750
VHSESDKAITPQAQEELQKQERESAKSELTES                                         1751 - 1782
//

Text Mined References (87)

PMID Year Title