Property Summary

NCBI Gene PubMed Count 69
PubMed Score 119.11
PubTator Score 67.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Mammary Neoplasms 410
Disease Target Count P-value
non-small cell lung cancer 2798 5.27074139857491E-16
psoriasis 6685 3.46556520431699E-8
tuberculosis 1563 1.06501310410205E-7
breast carcinoma 1614 2.03831675521008E-6
lung cancer 4473 8.5110292137408E-6
Duchenne muscular dystrophy 602 9.69091836255618E-6
group 4 medulloblastoma 1875 1.35728176285096E-5
ovarian cancer 8492 2.04208287058998E-5
chronic lymphosyte leukemia 232 2.92718232873117E-5
lung carcinoma 2844 3.14620827887424E-5
lung adenocarcinoma 2714 2.1160075362671E-4
invasive ductal carcinoma 2950 2.36031242840687E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 2.48402560626859E-4
pancreatic cancer 2300 6.4788431730261E-4
primary pancreatic ductal adenocarcinoma 1271 8.51620279803726E-4
ductal carcinoma in situ 1745 9.11722748934854E-4
Atopic dermatitis 944 9.2811014039575E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00109669698930285
medulloblastoma, large-cell 6234 0.00115357776604568
atypical teratoid / rhabdoid tumor 4369 0.00535496568085444
cystic fibrosis 1670 0.0064458983044936
Gaucher disease type 3 76 0.00779716494815406
fibroadenoma 557 0.00793279263830444
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00887756594843991
ulcerative colitis 2087 0.0109343212383487
colon cancer 1475 0.0112294262374047
pituitary cancer 1972 0.012883011040188
astrocytic glioma 2241 0.0131334205742006
interstitial cystitis 2299 0.0131729921046437
ependymoma 2514 0.0172692059101268
gastric carcinoma 832 0.0277508119614125
oligodendroglioma 2849 0.0299403324067294
adrenocortical carcinoma 1427 0.030384779854813
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0340165768207433
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Myasthenia Gravis 26 3.414 1.7
Cancer 2346 3.338 1.7

Expression

Synonym

Accession Q02952 O00310 O00498 Q4LE68 Q5SZ80 Q5TGN1 Q68D82 Q99970 AKAP-12
Symbols SSeCKS
AKAP250

Gene

  Ortholog (8)

Gene RIF (50)

PMID Text
26646106 MiR-103 regulates hepatocellular carcinoma growth by targeting AKAP12
26645718 results suggest that the association between the 6q25.1 locus and breast cancer risk may be mediated through single nucleotide polymorphisms that regulate expressions of the AKAP12 gene.
26428665 The SSeCKS, a major Lipopolysaccharide (LPS) response protein, has been involved in regulating astrocyte activation via production of proinflammatory factor in CNS inflammation.
26406118 The authors propose that Gravin-mediated recruitment of Aurora A and Plk1 to the mother (oldest) spindle pole contributes to the fidelity of symmetric cell division.
25792458 AKAP12 variant 2 hypoxic induction shifts PKA-mediated protein phosphorylation to enhance migration and metastasis of melanoma cells
25748058 Elevated expression of AKAP12 is characteristic of paclitaxel-resistant high-grade serous ovarian cancer cells, and a prognostic and predictive marker for poor overall survival in SOC patients.
25637608 Cigarette smoke-induced changes in AKAP5 and AKAP12 in patients with COPD may affect efficacy of pharmacotherapy.
25356636 The enrichment of activated Cdc42 in SSeCKS-null leading edge filopodia correlated with recruitment of the Cdc42-specific guanine nucleotide exchange factor, Frabin.
25229625 AKAP12 scaffolding protein mediates meningeal reconstruction after central nervous system injury
25188285 PKA compartmentalization via AKAP220 and AKAP12 contributes to endothelial barrier regulation.
More...

AA Sequence

MGAGSSTEQRSPEQPPEGSSTPAEPEPSGGGPSAEAAPDTTADPAIAASDPATKLLQKNGQLSTINGVAE      1 - 70
QDELSLQEGDLNGQKGALNGQGALNSQEEEEVIVTEVGQRDSEDVSKRDSDKEMATKSAVVHDITDDGQE     71 - 140
ETPEIIEQIPSSESNLEELTQPTESQANDIGFKKVFKFVGFKFTVKKDKTEKPDTVQLLTVKKDEGEGAA    141 - 210
GAGDHKDPSLGAGEAASKESEPKQSTEKPEETLKREQSHAEISPPAESGQAVEECKEEGEEKQEKEPSKS    211 - 280
AESPTSPVTSETGSTFKKFFTQGWAGWRKKTSFRKPKEDEVEASEKKKEQEPEKVDTEEDGKAEVASEKL    281 - 350
TASEQAHPQEPAESAHEPRLSAEYEKVELPSEEQVSGSQGPSEEKPAPLATEVFDEKIEVHQEEVVAEVH    351 - 420
VSTVEERTEEQKTEVEETAGSVPAEELVEMDAEPQEAEPAKELVKLKETCVSGEDPTQGADLSPDEKVLS    421 - 490
KPPEGVVSEVEMLSSQERMKVQGSPLKKLFTSTGLKKLSGKKQKGKRGGGDEESGEHTQVPADSPDSQEE    491 - 560
QKGESSASSPEEPEEITCLEKGLAEVQQDGEAEEGATSDGEKKREGVTPWASFKKMVTPKKRVRRPSESD    561 - 630
KEDELDKVKSATLSSTESTASEMQEEMKGSVEEPKPEEPKRKVDTSVSWEALICVGSSKKRARRGSSSDE    631 - 700
EGGPKAMGGDHQKADEAGKDKETGTDGILAGSQEHDPGQGSSSPEQAGSPTEGEGVSTWESFKRLVTPRK    701 - 770
KSKSKLEEKSEDSIAGSGVEHSTPDTEPGKEESWVSIKKFIPGRRKKRPDGKQEQAPVEDAGPTGANEDD    771 - 840
SDVPAVVPLSEYDAVEREKMEAQQAQKSAEQPEQKAATEVSKELSESQVHMMAAAVADGTRAATIIEERS    841 - 910
PSWISASVTEPLEQVEAEAALLTEEVLEREVIAEEEPPTVTEPLPENREARGDTVVSEAELTPEAVTAAE    911 - 980
TAGPLGAEEGTEASAAEETTEMVSAVSQLTDSPDTTEEATPVQEVEGGVPDIEEQERRTQEVLQAVAEKV    981 - 1050
KEESQLPGTGGPEDVLQPVQRAEAERPEEQAEASGLKKETDVVLKVDAQEAKTEPFTQGKVVGQTTPESF   1051 - 1120
EKAPQVTESIESSELVTTCQAETLAGVKSQEMVMEQAIPPDSVETPTDSETDGSTPVADFDAPGTTQKDE   1121 - 1190
IVEIHEENEVASGTQSGGTEAEAVPAQKERPPAPSSFVFQEETKEQSKMEDTLEHTDKEVSVETVSILSK   1191 - 1260
TEGTQEADQYADEKTKDVPFFEGLEGSIDTGITVSREKVTEVALKGEGTEEAECKKDDALELQSHAKSPP   1261 - 1330
SPVEREMVVQVEREKTEAEPTHVNEEKLEHETAVTVSEEVSKQLLQTVNVPIIDGAKEVSSLEGSPPPCL   1331 - 1400
GQEEAVCTKIQVQSSEASFTLTAAAEEEKVLGETANILETGETLEPAGAHLVLEEKSSEKNEDFAAHPGE   1401 - 1470
DAVPTGPDCQAKSTPVIVSATTKKGLSSDLEGEKTTSLKWKSDEVDEQVACQEVKVSVAIEDLEPENGIL   1471 - 1540
ELETKSSKLVQNIIQTAVDQFVRTEETATEMLTSELQTQAHVIKADSQDAGQETEKEGEEPQASAQDETP   1541 - 1610
ITSAKEESESTAVGQAHSDISKDMSEASEKTMTVEVEGSTVNDQQLEEVVLPSEEEGGGAGTKSVPEDDG   1611 - 1680
HALLAERIEKSLVEPKEDEKGDDVDDPENQNSALADTDASGGLTKESPDTNGPKQKEKEDAQEVELQEGK   1681 - 1750
VHSESDKAITPQAQEELQKQERESAKSELTES                                         1751 - 1782
//

Text Mined References (84)

PMID Year Title
26646106 2016 MiR-103 regulates hepatocellular carcinoma growth by targeting AKAP12.
26645718 2016 Evaluation of potential regulatory function of breast cancer risk locus at 6q25.1.
26428665 2015 HSPA12B regulates SSeCKS-mediated astrocyte inflammatory activation in neuroinflammation.
26406118 2015 A mitotic kinase scaffold depleted in testicular seminomas impacts spindle orientation in germ line stem cells.
25807930 2015 Multifunctional reagents for quantitative proteome-wide analysis of protein modification in human cells and dynamic profiling of protein lipidation during vertebrate development.
25792458 2015 Hypoxic induction of AKAP12 variant 2 shifts PKA-mediated protein phosphorylation to enhance migration and metastasis of melanoma cells.
25748058 2015 Elevated AKAP12 in paclitaxel-resistant serous ovarian cancer cells is prognostic and predictive of poor survival in patients.
25637608 2015 A-kinase-anchoring proteins coordinate inflammatory responses to cigarette smoke in airway smooth muscle.
25356636 2014 Suppression of chemotaxis by SSeCKS via scaffolding of phosphoinositol phosphates and the recruitment of the Cdc42 GEF, Frabin, to the leading edge.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
More...