Property Summary

NCBI Gene PubMed Count 23
PubMed Score 6.31
PubTator Score 6.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 8.42818583278413E-20
breast carcinoma 1614 1.1315319344261E-16
Breast cancer 3099 5.43149801264246E-13
non-small cell lung cancer 2798 2.79267981148277E-10
tuberculosis 1563 1.67467585424818E-8
group 4 medulloblastoma 1875 1.87030405848126E-5
glioblastoma 5572 3.03411726930138E-5
hepatocellular carcinoma 550 3.59797149665912E-5
pancreatic carcinoma 567 4.19761046159983E-5
pancreatic cancer 2300 4.19761046159984E-5
lung cancer 4473 3.0858562888829E-4
psoriasis 6685 3.55163723922204E-4
gastric cancer 436 7.87382908240736E-4
pediatric high grade glioma 2712 0.00193047716073123
ovarian cancer 8492 0.00404693191265245
Pick disease 1893 0.00414772676418735
invasive ductal carcinoma 2950 0.00549815387968031
Atopic dermatitis 944 0.00843574199124776
progressive supranuclear palsy 674 0.0127923477266346
astrocytic glioma 2241 0.013031805601436
ductal carcinoma in situ 1745 0.013645968165846
non primary Sjogren syndrome sicca 840 0.016793009825761
Rheumatoid Arthritis 1171 0.018023935284568
osteosarcoma 7933 0.0191008909786482
cutaneous lupus erythematosus 1056 0.0202796320459113
acute myeloid leukemia 785 0.0264084753476553
medulloblastoma, large-cell 6234 0.0275730379894709
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0329430050331144
Disease Target Count
bladder exstrophy 12

Expression

  Differential Expression (28)

Disease log2 FC p
Rheumatoid Arthritis 2.600 0.018
gastric cancer 1.200 0.001
hepatocellular carcinoma 1.700 0.000
pancreatic cancer 2.600 0.000
astrocytic glioma 1.100 0.013
cutaneous lupus erythematosus -1.100 0.020
psoriasis -1.900 0.000
osteosarcoma -1.604 0.019
glioblastoma 1.600 0.000
group 4 medulloblastoma -2.900 0.000
medulloblastoma, large-cell -1.300 0.028
Atopic dermatitis -1.100 0.008
tuberculosis 4.000 0.000
non-small cell lung cancer -1.091 0.000
intraductal papillary-mucinous carcinoma... -1.200 0.033
lung cancer -1.400 0.000
breast carcinoma -1.200 0.000
pediatric high grade glioma 1.400 0.002
non primary Sjogren syndrome sicca -1.100 0.017
pancreatic carcinoma 2.600 0.000
acute myeloid leukemia -1.600 0.026
lung carcinoma -1.900 0.000
Pick disease -1.400 0.004
progressive supranuclear palsy -2.000 0.013
Breast cancer -2.600 0.000
ductal carcinoma in situ -1.600 0.014
invasive ductal carcinoma -2.600 0.005
ovarian cancer -1.500 0.004

Synonym

Accession Q02930 A8KA51 B4DU13 B5BUH3 C9JK47 Q05886 Q06246 Q75N02 Q86UJ9 CREB-5
Symbols CREB-5
CRE-BPA

Gene

PANTHER Protein Class (1)

  Ortholog (9)

Gene RIF (5)

PMID Text
25076032 CREB5 accelerate the metastasis of colorectal cancer by regulating these five key genes.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20080650 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)

AA Sequence

MIYEESKMNLEQERPFVCSAPGCSQRFPTEDHLMIHRHKHEMTLKFPSIKTDNMLSDQTPTPTRFLKNCE      1 - 70
EVGLFSELDCSLEHEFRKAQEEESSKRNISMHNAVGGAMTGPGTHQLSSARLPNHDTNVVIQQAMPSPQS     71 - 140
SSVITQAPSTNRQIGPVPGSLSSLLHLHNRQRQPMPASMPGTLPNPTMPGSSAVLMPMERQMSVNSSIMG    141 - 210
MQGPNLSNPCASPQVQPMHSEAKMRLKAALTHHPAAMSNGNMNTMGHMMEMMGSRQDQTPHHHMHSHPHQ    211 - 280
HQTLPPHHPYPHQHQHPAHHPHPQPHHQQNHPHHHSHSHLHAHPAHHQTSPHPPLHTGNQAQVSPATQQM    281 - 350
QPTQTIQPPQPTGGRRRRVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNE    351 - 420
VSMLKNEVAQLKQLLLTHKDCPITAMQKESQGYLSPESSPPASPVPACSQQQVIQHNTITTSSSVSEVVG    421 - 490
SSTLSQLTTHRTDLNPIL                                                        491 - 508
//

Text Mined References (25)

PMID Year Title
25436638 2014 Genetic variants associated with serum thyroid stimulating hormone (TSH) levels in European Americans and African Americans from the eMERGE Network.
25416956 2014 A proteome-scale map of the human interactome network.
25076032 2014 Involvement of the CREB5 regulatory network in colorectal cancer metastasis.
24047446 2013 Genome-wide association study of co-occurring anxiety in major depression.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22837378 2012 Genome-wide association studies identify CHRNA5/3 and HTR4 in the development of airflow obstruction.
21666788 2011 Effects of chronic ascariasis and trichuriasis on cytokine production and gene expression in human blood: a cross-sectional study.
21441570 2011 Genome-wide meta-analysis for severe diabetic retinopathy.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20080650 2010 Inherited genetic variant predisposes to aggressive but not indolent prostate cancer.
More...