Property Summary

NCBI Gene PubMed Count 23
PubMed Score 6.31
PubTator Score 6.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
Rheumatoid Arthritis 2.600 0.018
gastric cancer 1.200 0.001
hepatocellular carcinoma 1.700 0.000
pancreatic cancer 2.600 0.000
astrocytic glioma 1.100 0.013
cutaneous lupus erythematosus -1.100 0.020
psoriasis -1.900 0.000
osteosarcoma -1.604 0.019
glioblastoma 1.600 0.000
group 4 medulloblastoma -2.900 0.000
medulloblastoma, large-cell -1.300 0.028
Atopic dermatitis -1.100 0.008
tuberculosis 4.000 0.000
non-small cell lung cancer -1.091 0.000
intraductal papillary-mucinous carcinoma... -1.200 0.033
lung cancer -1.400 0.000
breast carcinoma -1.200 0.000
pediatric high grade glioma 1.400 0.002
non primary Sjogren syndrome sicca -1.100 0.017
pancreatic carcinoma 2.600 0.000
acute myeloid leukemia -1.600 0.026
lung carcinoma -1.900 0.000
Pick disease -1.400 0.004
progressive supranuclear palsy -2.000 0.013
Breast cancer -2.600 0.000
ductal carcinoma in situ -1.600 0.014
invasive ductal carcinoma -2.600 0.005
ovarian cancer -1.500 0.004

Synonym

Accession Q02930 A8KA51 B4DU13 B5BUH3 C9JK47 Q05886 Q06246 Q75N02 Q86UJ9 CREB-5
Symbols CREB-5
CRE-BPA

Gene

PANTHER Protein Class (1)

Protein-protein Interaction (5)

Gene RIF (5)

PMID Text
25076032 CREB5 accelerate the metastasis of colorectal cancer by regulating these five key genes.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20080650 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)

AA Sequence

MIYEESKMNLEQERPFVCSAPGCSQRFPTEDHLMIHRHKHEMTLKFPSIKTDNMLSDQTPTPTRFLKNCE      1 - 70
EVGLFSELDCSLEHEFRKAQEEESSKRNISMHNAVGGAMTGPGTHQLSSARLPNHDTNVVIQQAMPSPQS     71 - 140
SSVITQAPSTNRQIGPVPGSLSSLLHLHNRQRQPMPASMPGTLPNPTMPGSSAVLMPMERQMSVNSSIMG    141 - 210
MQGPNLSNPCASPQVQPMHSEAKMRLKAALTHHPAAMSNGNMNTMGHMMEMMGSRQDQTPHHHMHSHPHQ    211 - 280
HQTLPPHHPYPHQHQHPAHHPHPQPHHQQNHPHHHSHSHLHAHPAHHQTSPHPPLHTGNQAQVSPATQQM    281 - 350
QPTQTIQPPQPTGGRRRRVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNE    351 - 420
VSMLKNEVAQLKQLLLTHKDCPITAMQKESQGYLSPESSPPASPVPACSQQQVIQHNTITTSSSVSEVVG    421 - 490
SSTLSQLTTHRTDLNPIL                                                        491 - 508
//

Publication (25)

PMID Year Title
25436638 2014 Genetic variants associated with serum thyroid stimulating hormone (TSH) levels in European Americans and African Americans from the eMERGE Network.
25416956 2014 A proteome-scale map of the human interactome network.
25076032 2014 Involvement of the CREB5 regulatory network in colorectal cancer metastasis.
24047446 2013 Genome-wide association study of co-occurring anxiety in major depression.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22837378 2012 Genome-wide association studies identify CHRNA5/3 and HTR4 in the development of airflow obstruction.
21666788 2011 Effects of chronic ascariasis and trichuriasis on cytokine production and gene expression in human blood: a cross-sectional study.
21441570 2011 Genome-wide meta-analysis for severe diabetic retinopathy.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20080650 2010 Inherited genetic variant predisposes to aggressive but not indolent prostate cancer.
More...