Property Summary

NCBI Gene PubMed Count 57
Grant Count 80
R01 Count 26
Funding $22,207,481.42
PubMed Score 88.71
PubTator Score 101.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 1.300 0.001
osteosarcoma 2.509 0.000
lung cancer -1.200 0.001
diabetes mellitus 1.400 0.002
ovarian cancer 1.500 0.000

Synonym

Accession Q02928 Q06766 Q16865 Q16866 Q5VSP8 Q86SU6 Q8IWY5
Symbols CP4Y
CYP4A2
CYP4AII

Gene

PANTHER Protein Class (2)

Protein-protein Interaction (1)

Gene RIF (45)

PMID Text
25947240 Interaction among CYP2C8, EPHX2, and CYP4A11 Gene Variants Significantly Increases the Risk for Ischemic Stroke.
25760539 The present study focused on 10 CYP4A11 variant alleles and evaluated their functional characteristics using arachidonic acid as the substrate in a COS-7 cell-based expression system.
25734770 To evaluate the associations between four single-nucleotide polymorphisms (SNPs) in CYP4A11 and CYP4F2 and ischemic stroke (IS)
25203493 Results indicate that both the transfer of an electron to the ferrous.O2 complex and C-H bond-breaking limit the rate of CYP4A11 ( cytochrome P450 4A11) omega-oxidation.
25064769 individuals homozygous for the CYP4A11 rs3890011 C allele, blood pressure is resistant to mineralocorticoid receptor antagonism, but sensitive to ENaC inhibition, consistent with ENaC activation.
24931260 This meta-analysis suggests the CYP4A11 T8590C polymorphism may be a risk factor for hypertension.
24535879 The results suggest that the CYP4A11 GG genotype was a high risk factor for hypertension.
24278241 suggests there is a significant association between the CYP4A11 T8590C variant and essential hypertension, especially in Caucasians. The case-control study did not find a significant association among the Han Chinese population
24164311 The CC genotype and C allele of the CYP4A11 gene were associated with essential hypertension in the male western Chinese Han population.
23859711 This meta-analysis revealed that the RGS2 1891-1892del TC polymorphism and CYP4A11 T8590C polymorphism were associated with hypertension risk.
More...

AA Sequence

MSVSVLSPSRLLGDVSGILQAASLLILLLLLIKAVQLYLHRQWLLKALQQFPCPPSHWLFGHIQELQQDQ      1 - 70
ELQRIQKWVETFPSACPHWLWGGKVRVQLYDPDYMKVILGRSDPKSHGSYRFLAPWIGYGLLLLNGQTWF     71 - 140
QHRRMLTPAFHYDILKPYVGLMADSVRVMLDKWEELLGQDSPLEVFQHVSLMTLDTIMKCAFSHQGSIQV    141 - 210
DRNSQSYIQAISDLNNLVFSRVRNAFHQNDTIYSLTSAGRWTHRACQLAHQHTDQVIQLRKAQLQKEGEL    211 - 280
EKIKRKRHLDFLDILLLAKMENGSILSDKDLRAEVDTFMFEGHDTTASGISWILYALATHPKHQERCREE    281 - 350
IHSLLGDGASITWNHLDQMPYTTMCIKEALRLYPPVPGIGRELSTPVTFPDGRSLPKGIMVLLSIYGLHH    351 - 420
NPKVWPNPEVFDPFRFAPGSAQHSHAFLPFSGGSRNCIGKQFAMNELKVATALTLLRFELLPDPTRIPIP    421 - 490
IARLVLKSKNGIHLRLRRLPNPCEDKDQL                                             491 - 519
//

Publication (60)

PMID Year Title
25947240 2015 Interaction among CYP2C8, EPHX2, and CYP4A11 Gene Variants Significantly Increases the Risk for Ischemic Stroke in Chinese Populations.
25760539 2015 Functional characterization of 10 CYP4A11 allelic variants to evaluate the effect of genotype on arachidonic acid ?-hydroxylation.
25734770 2015 Cytochrome 4A11 Genetic Polymorphisms Increase Susceptibility to Ischemic Stroke and Associate with Atherothrombotic Events After Stroke in Chinese.
25203493 2014 Kinetic analysis of lauric acid hydroxylation by human cytochrome P450 4A11.
25064769 2014 Genetic variation in CYP4A11 and blood pressure response to mineralocorticoid receptor antagonism or ENaC inhibition: an exploratory pilot study in African Americans.
24931260 2014 T8590C polymorphism of CYP4A11 is a risk factor for hypertension: a meta-analysis.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24535879 2014 Association of a CYP4A11 polymorphism and hypertension in the Mongolian and Han populations of China.
24278241 2013 Association between the CYP4A11 T8590C variant and essential hypertension: new data from Han Chinese and a meta-analysis.
24164311 2014 CYP4A11 gene T8590C polymorphism is associated with essential hypertension in the male western Chinese Han population.
More...