Property Summary

Ligand Count 3
NCBI Gene PubMed Count 85
PubMed Score 253.47
PubTator Score 203.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Leukemia, Myeloid 18 0.0 0.0
Prostatic Intraepithelial Neoplasia 11 0.0 0.0
Disease Target Count
Abdominal abscess 2
Acute Moraxella catarrhalis bronchitis 1
Acute bacterial bronchitis 1
Acute bacterial peritonitis 1
Acute bacterial sinusitis 1
Acute gonococcal cervicitis 1
Acute gonococcal urethritis 1
Acute maxillary sinusitis 2
Acute osteomyelitis 1
Anthrax 1
Bacterial Corneal Ulcer Infection 1
Bacterial conjunctivitis 10
Bacterial infection due to Klebsiella pneumoniae 2
Bacterial pneumonia 4
Bacterial urinary infection 2
Chancroid 8
Chronic Bacterial Prostatitis 1
Citrobacter Urinary Tract Infection 1
Complicated Bacterial Peritonitis 1
Complicated Bacteroides Peritonitis 1
Complicated E. Coli Peritonitis 1
Complicated Klebsiella Peritonitis 1
Complicated Proteus UTI 1
Complicated UTI with Pseudomonas Aeruginosa 1
Cystitis 15
Diarrhea due to E. Coli 1
E. Coli Cystitis 1
E. Coli Pyelonephritis 1
Enteric campylobacteriosis 1
Enterobacter Osteomyelitis 1
Enterobacter Pneumonia 2
EnterobacterJoint Infection 1
Enterococcus Complicated UTI 1
Enterococcus Urinary Tract Infection 1
Escherichia coli urinary tract infection 1
Gram-Negative Aerobic Bacillary Pneumonia 2
Haemophilus Parainfluenzae Pneumonia 1
Haemophilus influenzae pneumonia 2
Infection due to Enterobacteriaceae 1
Infection due to Escherichia coli 1
Infection due to Pseudomonas aeruginosa 1
Infection due to Staphylococcus aureus 1
Infection of bone 19
Infection of skin AND/OR subcutaneous tissue 2
Infectious diarrheal disease 1
Infectious disease of abdomen 2
Infectious disorder of joint 2
Infective cystitis 1
Infective otitis externa 4
Infective otitis media 3
Klebsiella Nosocomial Pneumonia 1
Klebsiella cystitis 1
Lower respiratory tract infection 14
Malignant otitis externa due to Pseudomonas aeruginosa 4
Moraxella Catarrhalis Chronic Bronchitis 1
Morganella Morganii Urinary Tract Infection 1
Nosocomial Pneumonia due to Haemophilus Influenzae 1
Nosocomial pneumonia 1
Otitis externa 10
Pneumonia due to Escherichia coli 2
Pneumonia due to Pseudomonas 1
Pneumonia due to Streptococcus 2
Prostatitis 18
Proteus Prostatitis 1
Proteus pneumonia 1
Proteus urinary tract infection 1
Providencia Urinary Tract Infection 1
Pseudomonas Aeruginosa Joint Infection 1
Pseudomonas Aeruginosa Osteomyelitis 1
Pseudomonas Aeruginosa Urinary Tract Infection 1
Rhinoscleroma 5
Septicemia due to Escherichia coli 1
Serratia Joint Infection 1
Serratia Osteomyelitis 1
Serratia Urinary Tract Infection 1
Shigellosis 21
Skin and Skin Structure Citrobacter Infection 1
Skin and Skin Structure Morganella Morganii Infection 1
Skin and Skin Structure Proteus Infection 1
Skin and Skin Structure Providencia Infection 1
Skin and Skin Structure Pseudomonas Aeruginosa Infection 1
Skin and Skin Structure Serratia Infection 1
Staphylococcus Aureus Otitis Externa 4
Staphylococcus Cystitis 1
Staphylococcus Epidermidis Skin and Skin Structure Infection 1
Staphylococcus Epidermidis Urinary Tract Infection 1
Staphylococcus Saprophyticus Urinary Tract Infection 1
Streptococcus pyogenes infection 1
Typhoid fever 22
Urinary tract infection caused by Klebsiella 1
Disease Target Count P-value
lung cancer 4740 1.8e-04
dermatomyositis 966 4.6e-04
Waldenstrons macroglobulinemia 765 2.4e-03
group 3 medulloblastoma 4104 1.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.7
Disease Target Count Z-score Confidence
Osteoporosis 363 0.0 1.7
Disease Target Count Z-score Confidence
Cancer 2499 4.507 2.3
Vaccinia 36 3.11 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
dermatomyositis 1.200 4.6e-04
group 3 medulloblastoma 1.100 1.7e-02
lung cancer 1.300 1.8e-04
Waldenstrons macroglobulinemia 1.858 2.4e-03

Protein-protein Interaction (1)

Gene RIF (55)

AA Sequence

MAKSGGCGAGAGVGGGNGALTWVTLFDQNNAAKKEESETANKNDSSKKLSVERVYQKKTQLEHILLRPDT      1 - 70
YIGSVEPLTQFMWVYDEDVGMNCREVTFVPGLYKIFDEILVNAADNKQRDKNMTCIKVSIDPESNIISIW     71 - 140
NNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETACKEYKHS    141 - 210
FKQTWMNNMMKTSEAKIKHFDGEDYTCITFQPDLSKFKMEKLDKDIVALMTRRAYDLAGSCRGVKVMFNG    211 - 280
KKLPVNGFRSYVDLYVKDKLDETGVALKVIHELANERWDVCLTLSEKGFQQISFVNSIATTKGGRHVDYV    281 - 350
VDQVVGKLIEVVKKKNKAGVSVKPFQVKNHIWVFINCLIENPTFDSQTKENMTLQPKSFGSKCQLSEKFF    351 - 420
KAASNCGIVESILNWVKFKAQTQLNKKCSSVKYSKIKGIPKLDDANDAGGKHSLECTLILTEGDSAKSLA    421 - 490
VSGLGVIGRDRYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKSYDDAESLKTLRYGKIMIM    491 - 560
TDQDQDGSHIKGLLINFIHHNWPSLLKHGFLEEFITPIVKASKNKQELSFYSIPEFDEWKKHIENQKAWK    561 - 630
IKYYKGLGTSTAKEAKEYFADMERHRILFRYAGPEDDAAITLAFSKKKIDDRKEWLTNFMEDRRQRRLHG    631 - 700
LPEQFLYGTATKHLTYNDFINKELILFSNSDNERSIPSLVDGFKPGQRKVLFTCFKRNDKREVKVAQLAG    701 - 770
SVAEMSAYHHGEQALMMTIVNLAQNFVGSNNINLLQPIGQFGTRLHGGKDAASPRYIFTMLSTLARLLFP    771 - 840
AVDDNLLKFLYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWACKLPNYDAREIVNNVRRMLDGLDPHPML    841 - 910
PNYKNFKGTIQELGQNQYAVSGEIFVVDRNTVEITELPVRTWTQVYKEQVLEPMLNGTDKTPALISDYKE    911 - 980
YHTDTTVKFVVKMTEEKLAQAEAAGLHKVFKLQTTLTCNSMVLFDHMGCLKKYETVQDILKEFFDLRLSY    981 - 1050
YGLRKEWLVGMLGAESTKLNNQARFILEKIQGKITIENRSKKDLIQMLVQRGYESDPVKAWKEAQEKAAE   1051 - 1120
EDETQNQHDDSSSDSGTPSGPDFNYILNMSLWSLTKEKVEELIKQRDAKGREVNDLKRKSPSDLWKEDLA   1121 - 1190
AFVEELDKVESQEREDVLAGMSGKAIKGKVGKPKVKKLQLEETMPSPYGRRIIPEITAMKADASKKLLKK   1191 - 1260
KKGDLDTAAVKVEFDEEFSGAPVEGAGEEALTPSVPINKGPKPKREKKEPGTRVRKTPTSSGKPSAKKVK   1261 - 1330
KRNPWSDDESKSESDLEETEPVVIPRDSLLRRAAAERPKYTFDFSEEEDDDADDDDDDNNDLEELKVKAS   1331 - 1400
PITNDGEDEFVPSDGLDKDEYTFSPGKSKATPEKSLHDKKSQDFGNLFSFPSYSQKSEDDSAKFDSNEED   1401 - 1470
SASVFSPSFGLKQTDKVPSKTVAAKKGKPSSDTVPKPKRAPKQKKVVEAVNSDSDSEFGIPKKTTTPKGK   1471 - 1540
GRGAKKRKASGSENEGDYNPGRKTSKTTSKKPKKTSFDQDSDVDIFPSDFPTEPPSLPRTGRARKEVKYF   1541 - 1610
AESDEEEDDVDFAMFN                                                         1611 - 1626
//

Text Mined References (105)

PMID Year Title