Property Summary

NCBI Gene PubMed Count 79
Grant Count 300
R01 Count 222
Funding $56,290,199.78
PubMed Score 235.45
PubTator Score 203.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (99)

Disease Z-score Confidence
Cancer 2,346 4.433 2.2
Vaccinia 37 3.116 1.6
Abdominal abscess 2
Acute Moraxella catarrhalis bronchitis 1
Acute bacterial bronchitis 1
Acute bacterial peritonitis 1
Acute bacterial sinusitis 1
Acute gonococcal cervicitis 1
Acute gonococcal urethritis 1
Acute maxillary sinusitis 3
Acute osteomyelitis 1
Anthrax 1
Bacterial Corneal Ulcer Infection 1
Bacterial conjunctivitis 10
Bacterial infection due to Klebsiella pn... 2 
Bacterial pneumonia 3
Bacterial urinary infection 2
Chancroid 8
Chronic Bacterial Prostatitis 1
Citrobacter Urinary Tract Infection 1
Complicated Bacterial Peritonitis 1
Complicated Bacteroides Peritonitis 1
Complicated E. Coli Peritonitis 1
Complicated Klebsiella Peritonitis 1
Complicated Proteus UTI 1
Complicated UTI with Pseudomonas Aerugin... 1 
Cystitis 16
Diarrhea due to E. Coli 1
E. Coli Cystitis 1
E. Coli Pyelonephritis 1
Enteric campylobacteriosis 1
Enterobacter Osteomyelitis 1
Enterobacter Pneumonia 2
EnterobacterJoint Infection 1
Enterococcus Complicated UTI 1
Enterococcus Urinary Tract Infection 1
Escherichia coli urinary tract infection 1
Gram-Negative Aerobic Bacillary Pneumoni... 2 
Haemophilus Parainfluenzae Pneumonia 1
Haemophilus influenzae pneumonia 2
Infection due to Enterobacteriaceae 1
Infection due to Escherichia coli 1
Infection due to Pseudomonas aeruginosa 1
Infection due to Staphylococcus aureus 1
Infection of bone 2
Infection of skin AND/OR subcutaneous ti... 2 
Infectious diarrheal disease 1
Infectious disease of abdomen 2
Infectious disorder of joint 2
Infective cystitis 1
Infective otitis externa 4
Infective otitis media 3
Klebsiella Complicated UTI 1
Klebsiella Nosocomial Pneumonia 1
Klebsiella cystitis 1
Lower respiratory tract infection 2
Malignant otitis externa due to Pseudomo... 4 
Moraxella Catarrhalis Chronic Bronchitis 1
Morganella Morganii Urinary Tract Infect... 1 
Myeloid Leukemia 19
Nosocomial Pneumonia due to Haemophilus ... 1 
Nosocomial pneumonia 1
Osteoporosis 257 1.0
Otitis externa 9
Pneumonia due to Escherichia coli 2
Pneumonia due to Pseudomonas 1
Pneumonia due to Streptococcus 2
Prostatic Intraepithelial Neoplasias 11
Prostatitis 15
Proteus Prostatitis 1
Proteus pneumonia 1
Proteus urinary tract infection 1
Providencia Urinary Tract Infection 1
Pseudomonas Aeruginosa Joint Infection 1
Pseudomonas Aeruginosa Osteomyelitis 1
Pseudomonas Aeruginosa Urinary Tract Inf... 1 
Rhinoscleroma 5
Septicemia due to Escherichia coli 1
Serratia Joint Infection 1
Serratia Osteomyelitis 1
Serratia Urinary Tract Infection 1
Shigellosis 16
Skin and Skin Structure Citrobacter Infe... 1 
Skin and Skin Structure Morganella Morga... 1 
Skin and Skin Structure Proteus Infectio... 1 
Skin and Skin Structure Providencia Infe... 1 
Skin and Skin Structure Pseudomonas Aeru... 1 
Skin and Skin Structure Serratia Infecti... 1 
Staphylococcus Aureus Otitis Externa 4
Staphylococcus Cystitis 1
Staphylococcus Epidermidis Skin and Skin... 1 
Staphylococcus Epidermidis Urinary Tract... 1 
Staphylococcus Saprophyticus Urinary Tra... 1 
Streptococcus pyogenes infection 1
Typhoid fever 22
Waldenstrons macroglobulinemia 765
dermatomyositis 933
group 3 medulloblastoma 2,254
lung cancer 4,466

Expression

  Differential Expression (4)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.858 0.002
lung cancer 1.300 0.000
group 3 medulloblastoma 1.100 0.017
dermatomyositis 1.200 0.000

Synonym

Accession Q02880 Q13600 Q9UMG8 Q9UQP8
Symbols TOPIIB
top2beta

Gene

PDB

3QX3   4G0U   4G0V   4G0W   4J3N  

Gene RIF (48)

PMID Text
26876283 TopoIIbeta is involved in the cascade of coactivator complexes that are recruited to LTR for regulation of HIV-1 transcription.
26612825 during early development, TOP2A is likely to have a role in cell proliferation, whereas TOP2B is expressed in post-mitotic cells and may be important in controlling expression of long genes even at this early stage.
26055322 A direct interaction between Ku70/86 and BRG1 brings together SWI/SNF remodeling capabilities and TOP2beta activity to enhance the transcriptional response to hormone stimulation.
25815590 Cinobufacini inhibited the proliferation of the HepG-2 cells induced apoptosis in a dose- and time-dependent manner and downregulated the mRNA and protein expression levels of TOPO I and TOPO II
25217229 Data suggest that DNA topoisomerase IIbeta (topoIIbeta) silencing can significantly alter the gene expression pattern of genes involved in variety of biological processes and signal transduction pathways.
25011107 Human cytomegalovirus IE1 exon 4 interacts with Topoisomerase IIbeta (TOPOIIbeta), whose activity is required for viral genome persistence and maintenance via binding to a cis-acting viral maintenance element.
24808172 Proteolytic degradation of Top2 enables the processing of Top2.DNA and Top2.RNA covalent complexes by TDP2.
24801450 This study demonstrated that top IIbeta overexpression is necessary for RA-induced neuronal differentiation.
24766193 These results are consistent with the hypothesis that etoposide quinone contributes to etoposide-related leukemogenesis through an interaction with topoisomerase IIbeta.
24326092 There is an association between chemosensitivity and Pgp, GST-pi and Topo II expression in gastric cancer.
More...

AA Sequence

MAKSGGCGAGAGVGGGNGALTWVTLFDQNNAAKKEESETANKNDSSKKLSVERVYQKKTQLEHILLRPDT      1 - 70
YIGSVEPLTQFMWVYDEDVGMNCREVTFVPGLYKIFDEILVNAADNKQRDKNMTCIKVSIDPESNIISIW     71 - 140
NNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETACKEYKHS    141 - 210
FKQTWMNNMMKTSEAKIKHFDGEDYTCITFQPDLSKFKMEKLDKDIVALMTRRAYDLAGSCRGVKVMFNG    211 - 280
KKLPVNGFRSYVDLYVKDKLDETGVALKVIHELANERWDVCLTLSEKGFQQISFVNSIATTKGGRHVDYV    281 - 350
VDQVVGKLIEVVKKKNKAGVSVKPFQVKNHIWVFINCLIENPTFDSQTKENMTLQPKSFGSKCQLSEKFF    351 - 420
KAASNCGIVESILNWVKFKAQTQLNKKCSSVKYSKIKGIPKLDDANDAGGKHSLECTLILTEGDSAKSLA    421 - 490
VSGLGVIGRDRYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKSYDDAESLKTLRYGKIMIM    491 - 560
TDQDQDGSHIKGLLINFIHHNWPSLLKHGFLEEFITPIVKASKNKQELSFYSIPEFDEWKKHIENQKAWK    561 - 630
IKYYKGLGTSTAKEAKEYFADMERHRILFRYAGPEDDAAITLAFSKKKIDDRKEWLTNFMEDRRQRRLHG    631 - 700
LPEQFLYGTATKHLTYNDFINKELILFSNSDNERSIPSLVDGFKPGQRKVLFTCFKRNDKREVKVAQLAG    701 - 770
SVAEMSAYHHGEQALMMTIVNLAQNFVGSNNINLLQPIGQFGTRLHGGKDAASPRYIFTMLSTLARLLFP    771 - 840
AVDDNLLKFLYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWACKLPNYDAREIVNNVRRMLDGLDPHPML    841 - 910
PNYKNFKGTIQELGQNQYAVSGEIFVVDRNTVEITELPVRTWTQVYKEQVLEPMLNGTDKTPALISDYKE    911 - 980
YHTDTTVKFVVKMTEEKLAQAEAAGLHKVFKLQTTLTCNSMVLFDHMGCLKKYETVQDILKEFFDLRLSY    981 - 1050
YGLRKEWLVGMLGAESTKLNNQARFILEKIQGKITIENRSKKDLIQMLVQRGYESDPVKAWKEAQEKAAE   1051 - 1120
EDETQNQHDDSSSDSGTPSGPDFNYILNMSLWSLTKEKVEELIKQRDAKGREVNDLKRKSPSDLWKEDLA   1121 - 1190
AFVEELDKVESQEREDVLAGMSGKAIKGKVGKPKVKKLQLEETMPSPYGRRIIPEITAMKADASKKLLKK   1191 - 1260
KKGDLDTAAVKVEFDEEFSGAPVEGAGEEALTPSVPINKGPKPKREKKEPGTRVRKTPTSSGKPSAKKVK   1261 - 1330
KRNPWSDDESKSESDLEETEPVVIPRDSLLRRAAAERPKYTFDFSEEEDDDADDDDDDNNDLEELKVKAS   1331 - 1400
PITNDGEDEFVPSDGLDKDEYTFSPGKSKATPEKSLHDKKSQDFGNLFSFPSYSQKSEDDSAKFDSNEED   1401 - 1470
SASVFSPSFGLKQTDKVPSKTVAAKKGKPSSDTVPKPKRAPKQKKVVEAVNSDSDSEFGIPKKTTTPKGK   1471 - 1540
GRGAKKRKASGSENEGDYNPGRKTSKTTSKKPKKTSFDQDSDVDIFPSDFPTEPPSLPRTGRARKEVKYF   1541 - 1610
AESDEEEDDVDFAMFN                                                         1611 - 1626
//

Text Mined References (97)

PMID Year Title
26876283 2016 TopoisomeraseII? in HIV-1 transactivation.
26612825 2016 Distinct expression patterns for type II topoisomerases IIA and IIB in the early foetal human telencephalon.
26055322 2015 Glucocorticoid Receptor Transcriptional Activation via the BRG1-Dependent Recruitment of TOP2? and Ku70/86.
25815590 2015 Effects of cinobufacini injection on cell proliferation and the expression of topoisomerases in human HepG-2 hepatocellular carcinoma cells.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25217229 2015 DNA topoisomerase II? as a molecular switch in neural differentiation of mesenchymal stem cells.
25011107 2014 Maintenance and replication of the human cytomegalovirus genome during latency.
24808172 2014 Proteolytic degradation of topoisomerase II (Top2) enables the processing of Top2·DNA and Top2·RNA covalent complexes by tyrosyl-DNA-phosphodiesterase 2 (TDP2).
More...