Property Summary

NCBI Gene PubMed Count 33
PubMed Score 37.76
PubTator Score 23.99

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

AA Sequence

MAGEKVEKPDTKEKKPEAKKVDAGGKVKKGNLKAKKPKKGKPHCSRNPVLVRGIGRYSRSAMYSRKAMYK      1 - 70
RKYSAAKSKVEKKKKEKVLATVTKPVGGDKNGGTRVVKLRKMPRYYPTEDVPRKLLSHGKKPFSQHVRKL     71 - 140
RASITPGTILIILTGRHRGKRVVFLKQLASGLLLVTGPLVLNRVPLRRTHQKFVIATSTKIDISNVKIPK    141 - 210
HLTDAYFKKKKLRKPRHQEGEIFDTEKEKYEITEQRKIDQKAVDSQILPKIKAIPQLQGYLRSVFALTNG    211 - 280
IYPHKLVF                                                                  281 - 288
//

Text Mined References (41)

PMID Year Title