| Tbio | Ras association domain-containing protein 7 |
Negatively regulates stress-induced JNK activation and apoptosis by promoting MAP2K7 phosphorylation and inhibiting its ability to activate JNK. Following prolonged stress, anti-apoptotic effect stops because of degradation of RASSF7 protein via the ubiquitin-proteasome pathway. Required for the activation of AURKB and chromosomal congression during mitosis where it stimulates microtubule polymerization.
Comments
| Disease | Target Count | P-value |
|---|---|---|
| ovarian cancer | 8492 | 1.98444304600119E-8 |
| pilocytic astrocytoma | 3086 | 1.30084561466638E-5 |
| group 4 medulloblastoma | 1875 | 4.28746246044107E-4 |
| breast carcinoma | 1614 | 0.00235020934462672 |
| Disease | log2 FC | p |
|---|---|---|
| breast carcinoma | 1.300 | 0.002 |
| group 4 medulloblastoma | -1.100 | 0.000 |
| pilocytic astrocytoma | -1.100 | 0.000 |
| ovarian cancer | -1.400 | 0.000 |
| Species | Source |
|---|---|
| Macaque | OMA Inparanoid |
| Mouse | OMA Inparanoid |
| Rat | OMA Inparanoid |
| Dog | OMA Inparanoid |
| Horse | OMA Inparanoid |
| Cow | OMA Inparanoid |
| Opossum | OMA Inparanoid |
| PMID | Text |
|---|---|
| 26569555 | truncated RASSF7 could act as an oncogene in a small subset of tumours where it is mutated in this way. |
| 22695170 | The RASSF gene family members RASSF5, RASSF6 and RASSF7 show frequent DNA methylation in neuroblastoma. |
| 21278800 | RASSF7 acts in concert with N-Ras to constitute a stress-sensitive temporary mechanism of apoptotic regulation. |
| 20629633 | RASSF7 regulates the microtubule cytoskeleton and is required for spindle formation, Aurora B activation and chromosomal congression during mitosis. |
| 19367319 | Observational study and meta-analysis of gene-disease association. (HuGE Navigator) |
| 15098441 | "rare" alleles of HRas1 minisatellite are associated with increased risk of papillary thyroid cancer formation in children and adolescents after Chernobyl accident |
MLLGLAAMELKVWVDGIQRVVCGVSEQTTCQEVVIALAQAIGQTGRFVLVQRLREKERQLLPQECPVGAQ 1 - 70 ATCGQFASDVQFVLRRTGPSLAGRPSSDSCPPPERCLIRASLPVKPRAALGCEPRKTLTPEPAPSLSRPG 71 - 140 PAAPVTPTPGCCTDLRGLELRVQRNAEELGHEAFWEQELRREQAREREGQARLQALSAATAEHAARLQAL 141 - 210 DAQARALEAELQLAAEAPGPPSPMASATERLHQDLAVQERQSAEVQGSLALVSRALEAAERALQAQAQEL 211 - 280 EELNRELRQCNLQQFIQQTGAALPPPPRPDRGPPGTQGPLPPAREESLLGAPSESHAGAQPRPRGGPHDA 281 - 350 ELLEVAAAPAPEWCPLAAQPQAL 351 - 373 //
| PMID | Year | Title |
|---|---|---|
| 26569555 | 2016 | Truncated RASSF7 promotes centrosomal defects and cell death. |
| 25416956 | 2014 | A proteome-scale map of the human interactome network. |
| 22695170 | 2012 | The RASSF gene family members RASSF5, RASSF6 and RASSF7 show frequent DNA methylation in neuroblastoma. |
| 21278800 | 2011 | RASSF7 negatively regulates pro-apoptotic JNK signaling by inhibiting the activity of phosphorylated-MKK7. |
| 20629633 | 2010 | Human RASSF7 regulates the microtubule cytoskeleton and is required for spindle formation, Aurora B activation and chromosomal congression during mitosis. |
| 19367319 | 2009 | Human longevity and 11p15.5: a study in 1321 centenarians. |
| 18272789 | 2008 | RASSF7 is a member of a new family of RAS association domain-containing proteins and is required for completing mitosis. |
| 16730941 | 2006 | A systematic analysis of human CHMP protein interactions: additional MIT domain-containing proteins bind to multiple components of the human ESCRT III complex. |
| 16554811 | 2006 | Human chromosome 11 DNA sequence and analysis including novel gene identification. |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). |
| More... |
