Property Summary

NCBI Gene PubMed Count 15
PubMed Score 10.36
PubTator Score 62.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 2.0e-08
Astrocytoma, Pilocytic 3081 1.3e-05
group 4 medulloblastoma 1855 4.3e-04
breast carcinoma 1638 2.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (4)

Disease log2 FC p
Astrocytoma, Pilocytic -1.100 1.3e-05
breast carcinoma 1.300 2.4e-03
group 4 medulloblastoma -1.100 4.3e-04
ovarian cancer -1.400 2.0e-08

Gene RIF (7)

AA Sequence

MLLGLAAMELKVWVDGIQRVVCGVSEQTTCQEVVIALAQAIGQTGRFVLVQRLREKERQLLPQECPVGAQ      1 - 70
ATCGQFASDVQFVLRRTGPSLAGRPSSDSCPPPERCLIRASLPVKPRAALGCEPRKTLTPEPAPSLSRPG     71 - 140
PAAPVTPTPGCCTDLRGLELRVQRNAEELGHEAFWEQELRREQAREREGQARLQALSAATAEHAARLQAL    141 - 210
DAQARALEAELQLAAEAPGPPSPMASATERLHQDLAVQERQSAEVQGSLALVSRALEAAERALQAQAQEL    211 - 280
EELNRELRQCNLQQFIQQTGAALPPPPRPDRGPPGTQGPLPPAREESLLGAPSESHAGAQPRPRGGPHDA    281 - 350
ELLEVAAAPAPEWCPLAAQPQAL                                                   351 - 373
//

Text Mined References (16)

PMID Year Title