Property Summary

NCBI Gene PubMed Count 29
Grant Count 70
R01 Count 30
Funding $10,812,577.2
PubMed Score 485.44
PubTator Score 129.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Rheumatoid Arthritis -1.500 0.048
ependymoma 1.100 0.004
psoriasis -1.800 0.000
astrocytoma 1.200 0.002
atypical teratoid / rhabdoid tumor 1.400 0.000
glioblastoma 1.500 0.000
pancreatic ductal adenocarcinoma liver m... -1.526 0.002
diabetes mellitus -1.200 0.002
group 3 medulloblastoma -1.300 0.008
COPD -1.300 0.011
dermatomyositis -1.600 0.001

Synonym

Accession Q02818 B2RD64 Q15838 Q7Z4J7 Q9BUR1
Symbols NUC
CALNUC

Gene

PDB

1SNL  

Gene RIF (10)

PMID Text
24995340 nesfatin-1 has a role in thyroid dysfunction in patients with T2DM
23195954 The serine protease activity of calnuc is allosterically regulated by Zn2+ binding and its interaction with G protein alpha subunit.
22542527 postulate that the engineered forms of NUCB1 prevent hIAPP fibril formation by a mechanism where protofibril-like species are "capped" to prevent further fibril assembly and maturation
21653697 structural basis for the properties of Calnuc and NUCB2 binding to Galpha subunits and its regulation by calcium ions.
20679342 Nucleobindin 1 is a calcium-regulated guanine nucleotide dissociation inhibitor of G{alpha}i1.
19656946 Proline residue at the +2-position (Pro(+2)) from the signal peptide cleavage site is the determinant of NUCB1 protein export from the ER and subsequent transport to the Golgi.
18154733 results suggest that the functions of nucleobindins could be modulated by caspase-mediated cleavage in apoptosis
17686766 NUCB1 is the first-identified, Golgi-localized negative feedback regulator in the ATF6-mediated branch of the UPR
17390015 Calnuc protein may be a tumor-associated antigen (TAA) that induces autoantibody response in human cancers
15287731 Comparison between the structure of nucleobindin and other EF-hand proteins sheds light into the dual function of nucleobindin as Ca2+ storage (buffer) and Ca2+ sensor.

AA Sequence

MPPSGPRGTLLLLPLLLLLLLRAVLAVPLERGAPNKEETPATESPDTGLYYHRYLQEVIDVLETDGHFRE      1 - 70
KLQAANAEDIKSGKLSRELDFVSHHVRTKLDELKRQEVSRLRMLLKAKMDAEQDPNVQVDHLNLLKQFEH     71 - 140
LDPQNQHTFEARDLELLIQTATRDLAQYDAAHHEEFKRYEMLKEHERRRYLESLGEEQRKEAERKLEEQQ    141 - 210
RRHREHPKVNVPGSQAQLKEVWEELDGLDPNRFNPKTFFILHDINSDGVLDEQELEALFTKELEKVYDPK    211 - 280
NEEDDMREMEEERLRMREHVMKNVDTNQDRLVTLEEFLASTQRKEFGDTGEGWETVEMHPAYTEEELRRF    281 - 350
EEELAAREAELNAKAQRLSQETEALGRSQGRLEAQKRELQQAVLHMEQRKQQQQQQQGHKAPAAHPEGQL    351 - 420
KFHPDTDDVPVPAPAGDQKEVDTSEKKLLERLPEVEVPQHL                                 421 - 461
//

Text Mined References (34)

PMID Year Title
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
24995340 2014 Decreased plasma nesfatin-1 level is related to the thyroid dysfunction in patients with type 2 diabetes mellitus.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24136289 2013 Identification and comparative analysis of hepatitis C virus-host cell protein interactions.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23234360 2013 LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins.
23195954 2013 Serine protease activity of calnuc: regulation by Zn2+ and G proteins.
22905912 2012 Resveratrol-induced changes of the human adipocyte secretion profile.
22542527 2012 Nucleobindin 1 caps human islet amyloid polypeptide protofibrils to prevent amyloid fibril formation.
21653697 2011 G Protein binding sites on Calnuc (nucleobindin 1) and NUCB2 (nucleobindin 2) define a new class of G(alpha)i-regulatory motifs.
More...