Property Summary

NCBI Gene PubMed Count 82
Grant Count 317
R01 Count 180
Funding $25,850,722.52
PubMed Score 516.76
PubTator Score 166.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
non-small cell lung cancer 1.303 0.000
lung cancer 2.100 0.000
breast carcinoma 1.400 0.000
Breast cancer 2.400 0.030
interstitial cystitis -1.100 0.000
adult high grade glioma -1.600 0.000
pilocytic astrocytoma -1.200 0.000
subependymal giant cell astrocytoma -1.923 0.047
lung carcinoma 1.100 0.000
ductal carcinoma in situ 1.100 0.019
invasive ductal carcinoma 1.700 0.011
ovarian cancer 1.100 0.000

Synonym

Accession Q02790 D3DUQ1 Q9UCP1 Q9UCV7 PPIase FKBP4
Symbols HBI
p52
Hsp56
FKBP51
FKBP52
FKBP59
PPIase

Gene

PANTHER Protein Class (1)

PDB

1N1A   1P5Q   1Q1C   1QZ2   4DRJ   4LAV   4LAW   4LAX   4LAY   4TW8  

Gene RIF (44)

PMID Text
26903089 The capacity FKBP52 to oligomerize Tau is not linked to its peptidyl-prolyl isomerase activity.
26207810 FKBP52 and beta-catenin interact directly in vitro. FKBP52 promotes beta-catenin interaction with androgen receptor signaling.
26065228 FKBP52 seems to be disrupted in preeclampsia and intrauterine growth restriction pregnancies
25986565 The Hsp90-associated FKBP52 cochaperone has become increasingly associated with aberrant steroid hormone receptor signaling in disease. [review]
25745955 FKBP4 was not differentially expressed in PTSD patients with low HPA axis reactivity compared to PTSD patients with high HPA axis reactivity.
25615537 FKBP51 is the major target accounting for the neuritotrophic effect of neuroimmunophilin ligands. Selectivity against the homolog FKBP52 is essential for optimal neuritotrophic efficacy.
25132599 identify a novel steroid-responsive FKBP52-dependent pathway suppressing the expression and activity of tryptophan-2,3-dioxygenase
25104352 The biological action of NF-kappaB in different cell types could be positively regulated by a high FKBP52/FKBP51 expression ratio.
24749623 Despite their substantial structural similarity, in both the beta3 bulge and the beta4-beta5 loop, the FK1 domain of FKBP51 undergoes significantly populated conformational transitions that appear to be suppressed in FKBP52.
24694367 Molecular chaperone activity and biological regulatory actions of the TPR-domain immunophilins FKBP51 and FKBP52
More...

AA Sequence

MTAEEMKATESGAQSAPLPMEGVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLLDGTKFDSS      1 - 70
LDRKDKFSFDLGKGEVIKAWDIAIATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGE     71 - 140
DLTEEEDGGIIRRIQTRGEGYAKPNEGAIVEVALEGYYKDKLFDQRELRFEIGEGENLDLPYGLERAIQR    141 - 210
MEKGEHSIVYLKPSYAFGSVGKEKFQIPPNAELKYELHLKSFEKAKESWEMNSEEKLEQSTIVKERGTVY    211 - 280
FKEGKYKQALLQYKKIVSWLEYESSFSNEEAQKAQALRLASHLNLAMCHLKLQAFSAAIESCNKALELDS    281 - 350
NNEKGLFRRGEAHLAVNDFELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAREKKLYANMFERLAE    351 - 420
EENKAKAEASSGDHPTDTEMKEEQKSNTAGSQSQVETEA                                   421 - 459
//

Text Mined References (95)

PMID Year Title
26903089 2016 Isomerization and Oligomerization of Truncated and Mutated Tau Forms by FKBP52 are Independent Processes.
26207810 2015 The FKBP52 Cochaperone Acts in Synergy with ?-Catenin to Potentiate Androgen Receptor Signaling.
26065228 2015 Expression of 52-kDa FK506-binding protein (FKBP52) in human placenta complicated by preeclampsia and intrauterine growth restriction.
25986565 2015 Therapeutic Targeting of the FKBP52 Co-Chaperone in Steroid Hormone Receptor-Regulated Physiology and Disease.
25745955 2015 Identification and characterization of HPA-axis reactivity endophenotypes in a cohort of female PTSD patients.
25615537 2015 FKBPs and their role in neuronal signaling.
25277244 2014 The functional landscape of Hsp27 reveals new cellular processes such as DNA repair and alternative splicing and proposes novel anticancer targets.
25132599 2015 Suppression of TDO-mediated tryptophan catabolism in glioblastoma cells by a steroid-responsive FKBP52-dependent pathway.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25104352 2014 NF-?B transcriptional activity is modulated by FK506-binding proteins FKBP51 and FKBP52: a role for peptidyl-prolyl isomerase activity.
More...