Property Summary

Ligand Count 3
NCBI Gene PubMed Count 89
PubMed Score 543.35
PubTator Score 166.49

Knowledge Summary


No data available


  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.600 1.4e-04
Astrocytoma, Pilocytic -1.200 9.0e-05
Breast cancer 2.400 3.0e-02
breast carcinoma 1.100 4.6e-04
ductal carcinoma in situ 1.100 1.9e-02
interstitial cystitis -1.100 3.4e-04
invasive ductal carcinoma 1.700 1.1e-02
lung cancer 1.800 4.7e-03
lung carcinoma 1.100 4.2e-25
malignant mesothelioma 1.300 1.6e-06
non-small cell lung cancer 1.303 7.8e-12
ovarian cancer 1.100 1.7e-04
subependymal giant cell astrocytoma -1.923 4.7e-02

Protein-protein Interaction (5)

Gene RIF (49)

AA Sequence

EENKAKAEASSGDHPTDTEMKEEQKSNTAGSQSQVETEA                                   421 - 459

Text Mined References (102)

PMID Year Title