Property Summary

NCBI Gene PubMed Count 29
Grant Count 31
R01 Count 13
Funding $3,868,967.5
PubMed Score 14.21
PubTator Score 30.55

Knowledge Summary

Patent (36,184)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Differentiating neuroblastoma 2 3.632 1.8

Expression

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (11)

PMID Text
23760366 MAP3K4 is sufficiently mediate the TGFbeta-induced phosphorylation of p38 MAPK in MEFs and HaCaT cells.
23178452 A novel and important role for MAP3K10 in the proliferation and chemoresistance of pancreatic ductal adenocarcinoma.
21979919 Mechanism of MAP kinase activation by TNF requires Src-dependent activation of Vav, activation of Rac/Cdc42, and the engagement of the Rac/Cdc42 interaction site on MLK3.
21979919 Mechanism of MAP kinase activation by TNF requires Src-dependent activation of Vav, activation of Rac/Cdc42, and the engagement of the Rac/Cdc42 interaction site on MLK2 and 3.
21678419 This study showed that show that RUNX3 is a principal and evolutionarily conserved component of the MST pathway.
20596961 Data show that miR-181b contributed to proliferation of AML cells by targeting MLK2.
19801649 Mixed lineage kinase phosphorylates transcription factor E47 and inhibits TrkB expression to link neuronal death and survival pathways
19332348 Hippocalcin and MLK2 were colocalized in the halo of Lewy bodies in Parkinson disease patients, and neither protein was detected in normal pigmented neurons.
17584736 MLK2 and -3 are required for activation of JNK and p38 by ectopically expressed GCK
15062575 demonstrate Alien-MLK2 interaction and also show that MLK2 is able to phosphorylate Alien; Alien, DAX-1 and thyroid hormone receptor mediated transcriptional silencing is strongly enhanced in the presence of active MLK2
More...

AA Sequence

MEEEEGAVAKEWGTTPAGPVWTAVFDYEAAGDEELTLRRGDRVQVLSQDCAVSGDEGWWTGQLPSGRVGV      1 - 70
FPSNYVAPGAPAAPAGLQLPQEIPFHELQLEEIIGVGGFGKVYRALWRGEEVAVKAARLDPEKDPAVTAE     71 - 140
QVCQEARLFGALQHPNIIALRGACLNPPHLCLVMEYARGGALSRVLAGRRVPPHVLVNWAVQVARGMNYL    141 - 210
HNDAPVPIIHRDLKSINILILEAIENHNLADTVLKITDFGLAREWHKTTKMSAAGTYAWMAPEVIRLSLF    211 - 280
SKSSDVWSFGVLLWELLTGEVPYREIDALAVAYGVAMNKLTLPIPSTCPEPFARLLEECWDPDPHGRPDF    281 - 350
GSILKRLEVIEQSALFQMPLESFHSLQEDWKLEIQHMFDDLRTKEKELRSREEELLRAAQEQRFQEEQLR    351 - 420
RREQELAEREMDIVERELHLLMCQLSQEKPRVRKRKGNFKRSRLLKLREGGSHISLPSGFEHKITVQASP    421 - 490
TLDKRKGSDGASPPASPSIIPRLRAIRLTPVDCGGSSSGSSSGGSGTWSRGGPPKKEELVGGKKKGRTWG    491 - 560
PSSTLQKERVGGEERLKGLGEGSKQWSSSAPNLGKSPKHTPIAPGFASLNEMEEFAEAEDGGSSVPPSPY    561 - 630
STPSYLSVPLPAEPSPGARAPWEPTPSAPPARWGHGARRRCDLALLGCATLLGAVGLGADVAEARAADGE    631 - 700
EQRRWLDGLFFPRAGRFPRGLSPPARPHGRREDVGPGLGLAPSATLVSLSSVSDCNSTRSLLRSDSDEAA    701 - 770
PAAPSPPPSPPAPTPTPSPSTNPLVDLELESFKKDPRQSLTPTHVTAACAVSRGHRRTPSDGALGQRGPP    771 - 840
EPAGHGPGPRDLLDFPRLPDPQALFPARRRPPEFPGRPTTLTFAPRPRPAASRPRLDPWKLVSFGRTLTI    841 - 910
SPPSRPDTPESPGPPSVQPTLLDMDMEGQNQDSTVPLCGAHGSH                              911 - 954
//

Text Mined References (32)

PMID Year Title
23760366 2013 The TGF?-induced phosphorylation and activation of p38 mitogen-activated protein kinase is mediated by MAP3K4 and MAP3K10 but not TAK1.
23178452 2013 MAP3K10 promotes the proliferation and decreases the sensitivity of pancreatic cancer cells to gemcitabine by upregulating Gli-1 and Gli-2.
21979919 2011 TNF-stimulated MAP kinase activation mediated by a Rho family GTPase signaling pathway.
21678419 2012 Identification of RUNX3 as a component of the MST/Hpo signaling pathway.
20596961 2010 microRNA-181b targets MLK2 in HL-60 cells.
19801649 2009 Mixed lineage kinase phosphorylates transcription factor E47 and inhibits TrkB expression to link neuronal death and survival pathways.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19332348 2009 Mixed lineage kinase 2 and hippocalcin are localized in Lewy bodies of Parkinson's disease.
18455992 2008 Application of active and kinase-deficient kinome collection for identification of kinases regulating hedgehog signaling.
More...