Property Summary

NCBI Gene PubMed Count 201
Grant Count 633
R01 Count 403
Funding $54,969,428.97
PubMed Score 855.58
PubTator Score 636.09

Knowledge Summary

Patent (148,559)

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytic glioma -1.500 0.020
ependymoma -1.500 0.027
oligodendroglioma -1.500 0.011
psoriasis 1.500 0.000
glioblastoma multiforme -1.200 0.000
osteosarcoma -2.051 0.006
cystic fibrosis 2.367 0.000
medulloblastoma, large-cell -2.100 0.003
adrenocortical carcinoma -2.467 0.000
non-small cell lung cancer -3.024 0.000
intraductal papillary-mucinous carcinoma... -2.000 0.001
intraductal papillary-mucinous neoplasm ... -2.100 0.006
lung cancer -4.700 0.000
interstitial cystitis 2.000 0.000
lung adenocarcinoma -3.600 0.000
lung carcinoma -2.700 0.000
invasive ductal carcinoma -2.000 0.001
ulcerative colitis 1.400 0.000
ovarian cancer 1.600 0.000

Synonym

Accession Q02763 A8K6W0 B4DH20 B4DHD3 D3DRK5 E7EWI2 Q5TCU2 Q8IV34
Symbols TIE2
VMCM
TIE-2
VMCM1
CD202B

Gene

TEK

PDB

1FVR   2GY5   2GY7   2OO8   2OSC   2P4I   2WQB   3BEA   3L8P   4K0V   4X3J  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (163)

PMID Text
26858516 dysregulation of the angiopoietin (Angpt)/Tie2 ligand receptor system may be crucial for endothelial dysfunction in hemolytic uremic syndrome
26659448 These results suggest that Tie2 signaling induces alpha4beta1 integrin activation on bone marrow-mast cell progenitor for adhesion to VCAM-1.
26642851 In the absence of Tie-2, VE-PTP inhibition destabilizes endothelial barrier integrity in agreement with the VE-cadherin-supportive effect of VE-PTP.
26489611 The inhibition of Tie-2 exerted by Tie-1can be relieved by Tie-1 ectodomain cleavage mediated by tumor- and inflammatory-related factors, which causes destabilization of vessels and initiates vessel remodeling in cancer. (Review)
26462497 pro-angiogenic Tie-2-expressing monocytes (TEM) and endothelial progenitor cells (EPC) play a crucial role in Critical limb ischemia.
26319232 we report the analysis of a comprehensive collection of 22 TIE2 mutations identified in patients with vascular morphogenesis
26269515 we show that VEGFA signaling from TIE2(hi) TMEM macrophages results in local, transient vascular permeability and tumor cell intravasation.
26258417 Rapamycin improves TIE2-mutated venous malformation
26115772 Data indicate that vascular malformations (VMs) are mediated by mutations in receptor tyrosine kinase Tie2 (TEK).
25909285 Data indicate that foretinib suppresses angiogenesis and lymphangiogenesis by blocking vascular endothelial growth factor receptors
More...

AA Sequence

MDSLASLVLCGVSLLLSGTVEGAMDLILINSLPLVSDAETSLTCIASGWRPHEPITIGRDFEALMNQHQD      1 - 70
PLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGEAIRIRTMKMRQQASFLPATLTMTVDKGDNVN     71 - 140
ISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPHAQPQDAGVYSARYIGGNLFTSAFTRLIVRR    141 - 210
CEAQKWGPECNHLCTACMNNGVCHEDTGECICPPGFMGRTCEKACELHTFGRTCKERCSGQEGCKSYVFC    211 - 280
LPDPYGCSCATGWKGLQCNEACHPGFYGPDCKLRCSCNNGEMCDRFQGCLCSPGWQGLQCEREGIQRMTP    281 - 350
KIVDLPDHIEVNSGKFNPICKASGWPLPTNEEMTLVKPDGTVLHPKDFNHTDHFSVAIFTIHRILPPDSG    351 - 420
VWVCSVNTVAGMVEKPFNISVKVLPKPLNAPNVIDTGHNFAVINISSEPYFGDGPIKSKKLLYKPVNHYE    421 - 490
AWQHIQVTNEIVTLNYLEPRTEYELCVQLVRRGEGGEGHPGPVRRFTTASIGLPPPRGLNLLPKSQTTLN    491 - 560
LTWQPIFPSSEDDFYVEVERRSVQKSDQQNIKVPGNLTSVLLNNLHPREQYVVRARVNTKAQGEWSEDLT    561 - 630
AWTLSDILPPQPENIKISNITHSSAVISWTILDGYSISSITIRYKVQGKNEDQHVDVKIKNATITQYQLK    631 - 700
GLEPETAYQVDIFAENNIGSSNPAFSHELVTLPESQAPADLGGGKMLLIAILGSAGMTCLTVLLAFLIIL    701 - 770
QLKRANVQRRMAQAFQNVREEPAVQFNSGTLALNRKVKNNPDPTIYPVLDWNDIKFQDVIGEGNFGQVLK    771 - 840
ARIKKDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKLGHHPNIINLLGACEHRGYLYLAIEYAPHGNL    841 - 910
LDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQFIHRDLAARNILVGENYVAKI    911 - 980
ADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCAELYEK    981 - 1050
LPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDCSA   1051 - 1120
EEAA                                                                     1121 - 1124
//

Text Mined References (217)

PMID Year Title
26858516 2015 Involvement of Angiopoietin-2 and Tie2 Receptor Phosphorylation in STEC-HUS Mediated by Escherichia coli O104:H4.
26659448 2015 Tie2 Signaling Enhances Mast Cell Progenitor Adhesion to Vascular Cell Adhesion Molecule-1 (VCAM-1) through ?4?1 Integrin.
26642851 2015 Interfering with VE-PTP stabilizes endothelial junctions in vivo via Tie-2 in the absence of VE-cadherin.
26489611 2015 Tie-1: A potential target for anti-angiogenesis therapy.
26462497 2016 Inflammation is associated with a reduced number of pro-angiogenic Tie-2 monocytes and endothelial progenitor cells in patients with critical limb ischemia.
26319232 2015 Common and specific effects of TIE2 mutations causing venous malformations.
26269515 2015 Real-Time Imaging Reveals Local, Transient Vascular Permeability, and Tumor Cell Intravasation Stimulated by TIE2hi Macrophage-Derived VEGFA.
26258417 2015 Rapamycin improves TIE2-mutated venous malformation in murine model and human subjects.
26115772 2015 Classification and Tie2 mutations in spinal and soft tissue vascular anomalies.
25909285 2015 Foretinib inhibits angiogenesis, lymphangiogenesis and tumor growth of pancreatic cancer in vivo by decreasing VEGFR-2/3 and TIE-2 signaling.
More...