Property Summary

NCBI Gene PubMed Count 22
PubMed Score 79.24
PubTator Score 28.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
active Crohn's disease -3.487 2.7e-03
active ulcerative colitis -2.915 3.0e-02
colon cancer -2.600 1.5e-05

Gene RIF (12)

AA Sequence

MNAFLLSALCLLGAWAALAGGVTVQDGNFSFSLESVKKLKDLQEPQEPRVGKLRNFAPIPGEPVVPILCS      1 - 70
NPNFPEELKPLCKEPNAQEILQRLEEIAEDPGTCEICAYAACTGC                              71 - 115
//

Text Mined References (23)

PMID Year Title