Property Summary

NCBI Gene PubMed Count 20
Grant Count 51
R01 Count 32
Funding $5,402,800.99
PubMed Score 61.33
PubTator Score 28.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
colon cancer -2.600 0.000
active Crohn's disease -3.487 0.003
ulcerative colitis -4.700 0.000

Gene RIF (10)

PMID Text
26362536 HIV-1 Gag interacts with GUCA2A as demonstrated by proximity dependent biotinylation proteomics
25899674 In summary the structural analysis of missense SNPs is important to decrease the number of potential mutations to be in vitro evaluated for associating them with some genetic diseases
20213926 The myristoylated wild-type GCAP1 was found to have the highest Ca(2+) affinity and thermal stability.
19742348 There is differential expression of guanylin in colorectal cancer, and the differential expression is associated with tumor stage.
15901896 Guanylin plays a role in the regulation of ion transport in the colon
15780094 human cortical collecting duct cells are depolarized by guanylin.
14988827 It is likely that gallbladder epithelial cells synthesize and release guanylin into the bile to regulate electrolyte secretion by a paracrine/luminocrine signaling pathway.
12707255 hormone prosequence interactions provide an explanation for the negligible bioactivity of the prohormone as well as the important role of the NH2-terminal residues in the disulfide-coupled folding of proguanylin
12463760 Results from circular dichroism and NMR spectroscopy validate native and recombinant proguanylin to be well-structured proteins adopting identical secondary structures and three-dimensional folds.
12163390 guanylin as a significant marker in salivary gland tumor pathology

AA Sequence

MNAFLLSALCLLGAWAALAGGVTVQDGNFSFSLESVKKLKDLQEPQEPRVGKLRNFAPIPGEPVVPILCS      1 - 70
NPNFPEELKPLCKEPNAQEILQRLEEIAEDPGTCEICAYAACTGC                              71 - 115
//

Text Mined References (21)

PMID Year Title
25899674 2015 Computational analyses and prediction of guanylin deleterious SNPs.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
20213926 2010 Calcium binding, structural stability and guanylate cyclase activation in GCAP1 variants associated with human cone dystrophy.
19742348 2009 [Differential expression of guanylin in colorectal cancer].
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15901896 2005 Guanylin and E. coli heat-stable enterotoxin induce chloride secretion through direct interaction with basolateral compartment of rat and human colonic cells.
15780094 2005 Guanylin and uroguanylin regulate electrolyte transport in isolated human cortical collecting ducts.
14988827 2004 Guanylin regulates chloride secretion in the human gallbladder via the bile fluid.
12707255 2003 Solution structure of human proguanylin: the role of a hormone prosequence.
12463760 2002 Native and recombinant proguanylin feature identical biophysical properties and are monomeric in solution.
More...