Property Summary

Ligand Count 3
NCBI Gene PubMed Count 84
PubMed Score 137.99
PubTator Score 180.06

Knowledge Summary

Patent (5,628)

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer 1.200 7.3e-10
pituitary cancer -6.300 1.2e-13

Gene RIF (65)

AA Sequence

MDRRMWGAHVFCVLSPLPTVLGHMHPECDFITQLREDESACLQAAEEMPNTTLGCPATWDGLLCWPTAGS      1 - 70
GEWVTLPCPDFFSHFSSESGAVKRDCTITGWSEPFPPYPVACPVPLELLAEEESYFSTVKIIYTVGHSIS     71 - 140
IVALFVAITILVALRRLHCPRNYVHTQLFTTFILKAGAVFLKDAALFHSDDTDHCSFSTVLCKVSVAASH    141 - 210
FATMTNFSWLLAEAVYLNCLLASTSPSSRRAFWWLVLAGWGLPVLFTGTWVSCKLAFEDIACWDLDDTSP    211 - 280
YWWIIKGPIVLSVGVNFGLFLNIIRILVRKLEPAQGSLHTQSQYWRLSKSTLFLIPLFGIHYIIFNFLPD    281 - 350
NAGLGIRLPLELGLGSFQGFIVAILYCFLNQEVRTEISRKWHGHDPELLPAWRTRAKWTTPSRSAAKVLT    351 - 420
SMC                                                                       421 - 423
//

Text Mined References (85)

PMID Year Title