Property Summary

NCBI Gene PubMed Count 24
PubMed Score 6.64
PubTator Score 9.59

Knowledge Summary

Patent (6,179)

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Malignant hyperthermia 26 4.025 2.0

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma -1.300 2.1e-02
osteosarcoma 1.151 3.4e-03
pediatric high grade glioma -1.100 2.2e-06
posterior fossa group A ependymoma -1.200 1.4e-10

 GWAS Trait (1)

Protein-protein Interaction (4)

Gene RIF (3)

AA Sequence

MVQKTSMSRGPYPPSQEIPMEVFDPSPQGKYSKRKGRFKRSDGSTSSDTTSNSFVRQGSAESYTSRPSDS      1 - 70
DVSLEEDREALRKEAERQALAQLEKAKTKPVAFAVRTNVGYNPSPGDEVPVQGVAITFEPKDFLHIKEKY     71 - 140
NNDWWIGRLVKEGCEVGFIPSPVKLDSLRLLQEQKLRQNRLGSSKSGDNSSSSLGDVVTGTRRPTPPASA    141 - 210
KQKQKSTEHVPPYDVVPSMRPIILVGPSLKGYEVTDMMQKALFDFLKHRFDGRISITRVTADISLAKRSV    211 - 280
LNNPSKHIIIERSNTRSSLAEVQSEIERIFELARTLQLVALDADTINHPAQLSKTSLAPIIVYIKITSPK    281 - 350
VLQRLIKSRGKSQSKHLNVQIAASEKLAQCPPEMFDIILDENQLEDACEHLAEYLEAYWKATHPPSSTPP    351 - 420
NPLLNRTMATAALAASPAPVSNLQGPYLASGDQPLERATGEHASMHEYPGELGQPPGLYPSSHPPGRAGT    421 - 490
LRALSRQDTFDADTPGSRNSAYTELGDSCVDMETDPSEGPGLGDPAGGGTPPARQGSWEDEEEDYEEELT    491 - 560
DNRNRGRNKARYCAEGGGPVLGRNKNELEGWGRGVYIR                                    561 - 598
//

Text Mined References (28)

PMID Year Title