Property Summary

NCBI Gene PubMed Count 22
PubMed Score 6.32
PubTator Score 9.59

Knowledge Summary

Patent (6,179)

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma 1.151 0.003
pediatric high grade glioma -1.100 0.000
group 3 medulloblastoma -1.300 0.021
posterior fossa group B ependymoma -1.300 0.000

 GWAS Trait (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
434974 screening 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen

Gene RIF (2)

PMID Text
21098446 CACNB1, encoding cardiac L-type calcium channel beta 1 subunit, is a potential target for microRNA-328 in transgenic mice.
19821165 Data show that the length-dependent mechanism of modulating inactivation kinetics of beta(2) calcium channel subunits can be confirmed and extended to the beta(1) calcium channel subunit.

AA Sequence

MVQKTSMSRGPYPPSQEIPMEVFDPSPQGKYSKRKGRFKRSDGSTSSDTTSNSFVRQGSAESYTSRPSDS      1 - 70
DVSLEEDREALRKEAERQALAQLEKAKTKPVAFAVRTNVGYNPSPGDEVPVQGVAITFEPKDFLHIKEKY     71 - 140
NNDWWIGRLVKEGCEVGFIPSPVKLDSLRLLQEQKLRQNRLGSSKSGDNSSSSLGDVVTGTRRPTPPASA    141 - 210
KQKQKSTEHVPPYDVVPSMRPIILVGPSLKGYEVTDMMQKALFDFLKHRFDGRISITRVTADISLAKRSV    211 - 280
LNNPSKHIIIERSNTRSSLAEVQSEIERIFELARTLQLVALDADTINHPAQLSKTSLAPIIVYIKITSPK    281 - 350
VLQRLIKSRGKSQSKHLNVQIAASEKLAQCPPEMFDIILDENQLEDACEHLAEYLEAYWKATHPPSSTPP    351 - 420
NPLLNRTMATAALAASPAPVSNLQGPYLASGDQPLERATGEHASMHEYPGELGQPPGLYPSSHPPGRAGT    421 - 490
LRALSRQDTFDADTPGSRNSAYTELGDSCVDMETDPSEGPGLGDPAGGGTPPARQGSWEDEEEDYEEELT    491 - 560
DNRNRGRNKARYCAEGGGPVLGRNKNELEGWGRGVYIR                                    561 - 598
//

Text Mined References (26)

PMID Year Title
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
21098446 2010 MicroRNA-328 contributes to adverse electrical remodeling in atrial fibrillation.
19821165 2010 Inactivation of L-type calcium channels is determined by the length of the N terminus of mutant beta(1) subunits.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14762176 2004 Molecular heterogeneity of calcium channel beta-subunits in canine and human heart: evidence for differential subcellular localization.
14760703 2004 Proteomic identification of brain proteins that interact with dynein light chain LC8.
More...