Property Summary

NCBI Gene PubMed Count 17
PubMed Score 17.41
PubTator Score 25.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Obesity 678 3.609 1.8
Disease Target Count Z-score Confidence
Prader-Willi syndrome 48 3.033 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
Atopic dermatitis -1.200 3.7e-03
cutaneous lupus erythematosus -2.200 1.6e-03
group 3 medulloblastoma 2.800 1.4e-02
posterior fossa group A ependymoma -1.200 2.7e-03

Gene RIF (7)

AA Sequence

MMLSPDQAADSDHPSSAHSDPESLGGTDTKVLGSVSDLEPVEEAEGDGKGGSRAALYPHPQQLSREEKRR      1 - 70
RRRATAKYRSAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV          71 - 135
//

Text Mined References (17)

PMID Year Title