Property Summary

NCBI Gene PubMed Count 17
Grant Count 2
Funding $29,240
PubMed Score 17.30
PubTator Score 25.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Synonym

Accession Q02577 Q5T1P6 HEN-2
Symbols HEN2
NSCL2
bHLHa34

Gene

 Grant Application (2)

Gene RIF (7)

PMID Text
26196864 These data support part of our hypothesis that NHLH2 or MAO-A polymorphism is associated with sedentary behavior.
24486192 Leptin signaling regulates hypothalamic expression of Nhlh2 through Stat3.
23026212 Two single nucleotide polymorphisms in the human nescient helix-loop-helix 2 (NHLH2) gene reduce mRNA stability or reduce helical structure in the DNA binding domain of the protein.
21573214 The present results suggest that a transcriptional complex of LMO3 and HEN2 may contribute to the genesis and malignant phenotype of neuroblastoma by inhibiting HES1 which suppresses the transactivation of Mash1.
19898481 Observational study of gene-disease association. (HuGE Navigator)
18815487 proposes the novel hypothesis that transcriptional activity by Nhlh2 (NHLH2 in humans) controls either the ability or the motivation for exercise [review]
15930276 The deregulated expression of neuronal-specific LMO3 and HEN2 contributes to the genesis and progression of human neuroblastoma in a lineage-specific manner.

AA Sequence

MMLSPDQAADSDHPSSAHSDPESLGGTDTKVLGSVSDLEPVEEAEGDGKGGSRAALYPHPQQLSREEKRR      1 - 70
RRRATAKYRSAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV          71 - 135
//

Text Mined References (17)

PMID Year Title
26196864 2015 A Genetic Basis for Motivated Exercise.
24486192 2014 Leptin signaling regulates hypothalamic expression of nescient helix-loop-helix 2 (Nhlh2) through signal transducer and activator 3 (Stat3).
23026212 2013 Two single nucleotide polymorphisms in the human nescient helix-loop-helix 2 (NHLH2) gene reduce mRNA stability and DNA binding.
22169038 2011 SIRT1 activates MAO-A in the brain to mediate anxiety and exploratory drive.
21573214 2011 Oncogenic LMO3 collaborates with HEN2 to enhance neuroblastoma cell growth through transactivation of Mash1.
19898481 2009 Genetic variants at CD28, PRDM1 and CD2/CD58 are associated with rheumatoid arthritis risk.
18815487 2008 Nhlh2: a basic helix-loop-helix transcription factor controlling physical activity.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16314316 2005 Human Bex2 interacts with LMO2 and regulates the transcriptional activity of a novel DNA-binding complex.
More...