Property Summary

NCBI Gene PubMed Count 103
Grant Count 111
R01 Count 57
Funding $13,088,961.14
PubMed Score 249.51
PubTator Score 120.46

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q02556 A0AV82 IRF-8
Symbols ICSBP
IRF-8
ICSBP1
IMD32A
IMD32B
H-ICSBP

Gene

PANTHER Protein Class (1)

 GO Component (2)

Gene RIF (75)

PMID Text
26613957 IRF5 and IRF8, two transcription factors with opposing functions, control TLR9 signaling in human plasmacytoid dendritic cells.
26563595 cytarabine-induced upregulation of the IRF8 in leukemic cells involves increased levels of ZNF224, which can counteract the repressive activity of WT1 on the IRF8-promoter
25989711 Results show that IRF8 is a possible genetic variant associated with the development of HT and production of thyroid antibody
25903733 This study demonstrated that the Polymorphism, Single Nucleotide of IRF8 is associated with multiple sclerosis in woman in Russia.
25880423 The IRF8 gene variant influenced the interaction between IRF8 and NF-kappaB and thus susceptibility to systemic sclerosis.
25749660 This article provides an overview of recent advances in our understanding of the role of IRF8 in myelopoiesis and related diseases. [review]
25453760 Irf8 forms a negative feedback loop with Cebpb, a monocyte-derived DC epigenetic fate-determining transcription factor.
25387409 Expression of WT1and IRF8 showed a moderate inverse correlation in acute myeloid leukemia patients. WT1 can be used as an minimal residual disease marker, especially in patients without recurrent genetic abnormalities.
25109451 Data demonstrate that IRF8 as a functional tumor suppressor is frequently methylated in RCC, and IRF8-mediated interferon signaling is involved in RCC pathogenesis.
24957708 MN1 prevents activation of the immune response pathway, and suggest restoration of IRF8 signaling as therapeutic target in AML
More...

AA Sequence

MCDRNGGRRLRQWLIEQIDSSMYPGLIWENEEKSMFRIPWKHAGKQDYNQEVDASIFKAWAVFKGKFKEG      1 - 70
DKAEPATWKTRLRCALNKSPDFEEVTDRSQLDISEPYKVYRIVPEEEQKCKLGVATAGCVNEVTEMECGR     71 - 140
SEIDELIKEPSVDDYMGMIKRSPSPPEACRSQLLPDWWAQQPSTGVPLVTGYTTYDAHHSAFSQMVISFY    141 - 210
YGGKLVGQATTTCPEGCRLSLSQPGLPGTKLYGPEGLELVRFPPADAIPSERQRQVTRKLFGHLERGVLL    211 - 280
HSSRQGVFVKRLCQGRVFCSGNAVVCKGRPNKLERDEVVQVFDTSQFFRELQQFYNSQGRLPDGRVVLCF    281 - 350
GEEFPDMAPLRSKLILVQIEQLYVRQLAEEAGKSCGAGSVMQAPEEPPPDQVFRMFPDICASHQRSFFRE    351 - 420
NQQITV                                                                    421 - 426
//

Text Mined References (104)

PMID Year Title
26613957 2016 IRF5 and IRF8 modulate the CAL-1 human plasmacytoid dendritic cell line response following TLR9 ligation.
26563595 2016 The hematopoietic tumor suppressor interferon regulatory factor 8 (IRF8) is upregulated by the antimetabolite cytarabine in leukemic cells involving the zinc finger protein ZNF224, acting as a cofactor of the Wilms' tumor gene 1 (WT1) protein.
25989711 2015 Association of IRF8 gene polymorphisms with autoimmune thyroid disease.
25903733 2015 GWAS-identified multiple sclerosis risk loci involved in immune response: validation in Russians.
25880423 2015 Identification of NF-?B and PLCL2 as new susceptibility genes and highlights on a potential role of IRF8 through interferon signature modulation in systemic sclerosis.
25749660 2015 Regulation of myelopoiesis by the transcription factor IRF8.
25453760 2014 A negative feedback loop of transcription factors specifies alternative dendritic cell chromatin States.
25387409 2015 Monitoring of WT1 and its target gene IRF8 expression in acute myeloid leukemia and their significance.
25122610 2014 Functional characterization of the human dendritic cell immunodeficiency associated with the IRF8(K108E) mutation.
25109451 2014 Interferon regulatory factor 8 functions as a tumor suppressor in renal cell carcinoma and its promoter methylation is associated with patient poor prognosis.
More...