Property Summary

NCBI Gene PubMed Count 146
PubMed Score 578.18
PubTator Score 1879.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
cutaneous lupus erythematosus 2.200 2.9e-02
group 4 medulloblastoma 3.000 9.0e-05
interstitial cystitis 3.600 2.4e-03
medulloblastoma, large-cell 3.200 1.9e-03
nasopharyngeal carcinoma -2.000 1.3e-03
osteosarcoma -3.333 2.2e-07
ovarian cancer -1.100 9.6e-04
primary Sjogren syndrome 3.100 1.0e-05
psoriasis 2.000 1.1e-29
tuberculosis and treatment for 3 months 1.100 3.8e-02
ulcerative colitis 2.300 5.5e-03

Gene RIF (119)

AA Sequence

MDLEKNYPTPRTSRTGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILG      1 - 70
RYYETGSIKPGVIGGSKPKVATPKVVEKIAEYKRQNPTMFAWEIRDRLLAERVCDNDTVPSVSSINRIIR     71 - 140
TKVQQPPNQPVPASSHSIVSTGSVTQVSSVSTDSAGSSYSISGILGITSPSADTNKRKRDEGIQESPVPN    141 - 210
GHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQTTEYSAMASLAGGLDDMKAN    211 - 280
LASPTPADIGSSVPGPQSYPIVTGRDLASTTLPGYPPHVPPAGQGSYSAPTLTGMVPGSEFSGSPYSHPQ    281 - 350
YSSYNDSWRFPNPGLLGSPYYYSAAARGAAPPAAATAYDRH                                 351 - 391
//

Text Mined References (147)

PMID Year Title