Property Summary

NCBI Gene PubMed Count 130
Grant Count 191
R01 Count 124
Funding $22,905,691.02
PubMed Score 546.32
PubTator Score 1879.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
cutaneous lupus erythematosus 2.200 0.029
osteosarcoma -3.333 0.000
group 4 medulloblastoma 3.000 0.000
medulloblastoma, large-cell 3.200 0.002
tuberculosis and treatment for 3 months 1.100 0.038
interstitial cystitis 3.600 0.002
primary Sjogren syndrome 3.100 0.000
nasopharyngeal carcinoma -2.000 0.001
ulcerative colitis 2.300 0.005
ovarian cancer -1.100 0.001
psoriasis 2.000 0.000

Gene

PDB

1K78   1MDM  

 GO Component (1)

Gene RIF (103)

PMID Text
27097569 PAX5 deletion is an independent risk factor for DFS in B-ALL children.
26823795 PAX2 and PAX5 are useful biomarker in the differential diagnosis of lung cancer
26782422 Our findings suggest that this mutation in a single allele of the PAX5 gene is not sufficient to cause disease, and it is possible that other alleles are also involved in the onset of B-ALL.
26703467 Authors demonstrate leukemogenicity of PAX5-PML by introducing it into normal mouse pro-B cells; B-cell linker protein (Blnk) is repressed by PAX5-PML in leukemia cells; enforced expression of Blnk increases survival despite introduction of PAX5-PML.
26304463 PAX5 methylated imprint margins may signify recurrence in head and neck squamous cell carcinoma
26073757 Differential PAX5 levels promote malignant B-cell infiltration, progression and drug resistance, and predict a poor prognosis in mantle cell lymphoma patients independent of CCND1.
25684485 Increased hypermethylation of PAX5 is associated with Triple negative breast cancer.
25662012 Study identified PAX5 as a novel EBER2-interacting protein, prompted by the observation that this transcription factor and the viral noncoding RNA co-localize at the tandem repeats, interaction appears to be indirect, based on the negative results of electrophoretic mobility shift assays and UV crosslinking experiments.
25633778 This is the first reported case of a novel complex variant translocation of t(11;14)(q13;q32) and t(9;14)(p13;q32)in PAX5-positive plasma cell myeloma.
25595912 Cells from PAX5 translocated patients show LCK up-regulation and over-activation, as well as STAT5 hyper-phosphorylation, compared to PAX5 wt and PAX5 deleted cases.
More...

AA Sequence

MDLEKNYPTPRTSRTGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILG      1 - 70
RYYETGSIKPGVIGGSKPKVATPKVVEKIAEYKRQNPTMFAWEIRDRLLAERVCDNDTVPSVSSINRIIR     71 - 140
TKVQQPPNQPVPASSHSIVSTGSVTQVSSVSTDSAGSSYSISGILGITSPSADTNKRKRDEGIQESPVPN    141 - 210
GHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQTTEYSAMASLAGGLDDMKAN    211 - 280
LASPTPADIGSSVPGPQSYPIVTGRDLASTTLPGYPPHVPPAGQGSYSAPTLTGMVPGSEFSGSPYSHPQ    281 - 350
YSSYNDSWRFPNPGLLGSPYYYSAAARGAAPPAAATAYDRH                                 351 - 391
//

Text Mined References (131)

PMID Year Title
27097569 2016 [Significance of PAX5 deletion in childhood B-lineage acute lymphoblastic leukemia without reproducible chromosomal abnormalities].
26823795 2015 Diagnostic utility of PAX2 and PAX5 in distinguishing non-small cell lung cancer from small cell lung cancer.
26782422 2015 One missense mutation in exon 2 of the PAX5 gene in Iran.
26703467 2016 B Cell Linker Protein (BLNK) Is a Selective Target of Repression by PAX5-PML Protein in the Differentiation Block That Leads to the Development of Acute Lymphoblastic Leukemia.
26304463 2015 Paired box 5 methylation detection by droplet digital PCR for ultra-sensitive deep surgical margins analysis of head and neck squamous cell carcinoma.
26073757 2016 Differential PAX5 levels promote malignant B-cell infiltration, progression and drug resistance, and predict a poor prognosis in MCL patients independent of CCND1.
25684485 2015 Increased hypermethylation of glutathione S-transferase P1, DNA-binding protein inhibitor, death associated protein kinase and paired box protein-5 genes in triple-negative breast cancer Saudi females.
25662012 2015 EBV noncoding RNA binds nascent RNA to drive host PAX5 to viral DNA.
25633778 2015 PAX5-positive plasma cell myeloma with t(9;14;11)(p13;q32;q13), a novel complex variant translocation of t(11;14)(q13;q32) and t(9;14)(p13;q32).
25595912 2015 LCK over-expression drives STAT5 oncogenic signaling in PAX5 translocated BCP-ALL patients.
More...