Property Summary

NCBI Gene PubMed Count 26
Grant Count 3
Funding $73,914
PubMed Score 18.10
PubTator Score 3.59

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q02543
Symbols L18A

Gene

PDB

4UG0   4V6X   5AJ0  

Gene RIF (2)

PMID Text
22944692 Positional proteomics analysis identifies the cleavage of human 60S ribosomal protein L18A (RPL18A) at amino acid residues 127-128 by the HIV-1 protease
16195786 L18a might influence the HCV IRES mediated translation.

AA Sequence

MKASGTLREYKVVGRCLPTPKCHTPPLYRMRIFAPNHVVAKSRFWYFVSQLKKMKKSSGEIVYCGQVFEK      1 - 70
SPLRVKNFGIWLRYDSRSGTHNMYREYRDLTTAGAVTQCYRDMGARHRARAHSIQIMKVEEIAASKCRRP     71 - 140
AVKQFHDSKIKFPLPHRVLRRQHKPRFTTKRPNTFF                                      141 - 176
//

Text Mined References (35)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
More...