Property Summary

NCBI Gene PubMed Count 26
PubMed Score 18.15
PubTator Score 3.59

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

AA Sequence

MKASGTLREYKVVGRCLPTPKCHTPPLYRMRIFAPNHVVAKSRFWYFVSQLKKMKKSSGEIVYCGQVFEK      1 - 70
SPLRVKNFGIWLRYDSRSGTHNMYREYRDLTTAGAVTQCYRDMGARHRARAHSIQIMKVEEIAASKCRRP     71 - 140
AVKQFHDSKIKFPLPHRVLRRQHKPRFTTKRPNTFF                                      141 - 176
//

Text Mined References (37)

PMID Year Title