Property Summary

NCBI Gene PubMed Count 33
Grant Count 80
R01 Count 50
Funding $11,847,492.1
PubMed Score 138.84
PubTator Score 137.11

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
Breast cancer 1.200 0.000
psoriasis 1.100 0.044

Synonym

Accession Q02539 Q3MJ34
Symbols H1A
H1.1
H1F1
HIST1

Gene

Gene RIF (11)

PMID Text
25482132 HIST1 cluster PcG methylation has a role in epigenesis in acute myeloid leukemia
24601643 Results suggest the potential for histone H1 phosphorylation at threonine 146 as a clinical biomarker in breast cancer.
24525734 Integration with apoptotic intermediates (via C-terminal tail interactions) may constitute a more generalized function of linker histone isoforms in apoptotic cascades.
21940793 fluorescence recovery after photobleaching analyses suggested that TAF-I beta enhances the dissociation of H1.1 from chromatin in the living cell
21425800 Data show that the multifunctional histone chaperone NPM1 interacts with linker histone H1 through its first acidic stretch (residues 120-132).
21425800 Overexpression of NPM1 enhances HIV-1 Tat-mediated transactivation by reducing the histone H1 occupancy on the chromatinized template of HIV-1 LTR
20800603 Observational study of gene-disease association. (HuGE Navigator)
20551309 Overexpression of NPM1 enhances HIV-1 Tat-mediated transactivation by reducing the histone H1 occupancy on the chromatinized template of HIV-1 LTR
20356835 histone H2A.X phosphorylation by DNA-dependent protein kinase is not affected by core histone acetylation, but it alters nucleosome stability and histone H1 binding
15595731 confirmed N-terminal acetylation on all isoforms plus a single internal acetylation site; phosphorylation sites were located on peptides containing the cyclin dependent kinase (CDK) consensus motif
More...

AA Sequence

MSETVPPAPAASAAPEKPLAGKKAKKPAKAAAASKKKPAGPSVSELIVQAASSSKERGGVSLAALKKALA      1 - 70
AAGYDVEKNNSRIKLGIKSLVSKGTLVQTKGTGASGSFKLNKKASSVETKPGASKVATKTKATGASKKLK     71 - 140
KATGASKKSVKTPKKAKKPAATRKSSKNPKKPKTVKPKKVAKSPAKAKAVKPKAAKARVTKPKTAKPKKA    141 - 210
APKKK                                                                     211 - 215
//

Text Mined References (35)

PMID Year Title
26689747 2016 Role of H1 linker histones in mammalian development and stem cell differentiation.
25482132 2015 PcG methylation of the HIST1 cluster defines an epigenetic marker of acute myeloid leukemia.
24601643 2014 Histone H1 phosphorylation in breast cancer.
24525734 2014 The C-terminal domain (CTD) in linker histones antagonizes anti-apoptotic proteins to modulate apoptotic outcomes at the mitochondrion.
22650316 2012 A unified phylogeny-based nomenclature for histone variants.
21940793 2011 Role of Template Activating Factor-I as a chaperone in linker histone dynamics.
21425800 2011 The multifunctional protein nucleophosmin (NPM1) is a human linker histone H1 chaperone.
21269460 2011 Initial characterization of the human central proteome.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20356835 2010 Phosphorylation of histone H2A.X by DNA-dependent protein kinase is not affected by core histone acetylation, but it alters nucleosome stability and histone H1 binding.
More...