Property Summary

NCBI Gene PubMed Count 35
PubMed Score 145.03
PubTator Score 137.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
Breast cancer 3577 1.6e-04
psoriasis 6694 4.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (2)

Disease log2 FC p
Breast cancer 1.200 1.6e-04
psoriasis 1.100 4.4e-02

Gene RIF (13)

AA Sequence

MSETVPPAPAASAAPEKPLAGKKAKKPAKAAAASKKKPAGPSVSELIVQAASSSKERGGVSLAALKKALA      1 - 70
AAGYDVEKNNSRIKLGIKSLVSKGTLVQTKGTGASGSFKLNKKASSVETKPGASKVATKTKATGASKKLK     71 - 140
KATGASKKSVKTPKKAKKPAATRKSSKNPKKPKTVKPKKVAKSPAKAKAVKPKAAKARVTKPKTAKPKKA    141 - 210
APKKK                                                                     211 - 215
//

Text Mined References (37)

PMID Year Title