Property Summary

NCBI Gene PubMed Count 83
PubMed Score 229.34
PubTator Score 143.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Immune system cancer 140 0.0 0.6
Lymphoid leukemia 160 0.0 0.6
Disease Target Count Z-score Confidence
Cancer 2499 3.828 1.9

Expression

  Differential Expression (32)

Disease log2 FC p
active Crohn's disease -1.805 3.8e-03
active ulcerative colitis -2.317 5.0e-03
adult high grade glioma 2.100 9.6e-05
astrocytic glioma 2.700 6.7e-03
Astrocytoma, Pilocytic 2.200 4.1e-07
atypical teratoid / rhabdoid tumor 2.800 1.4e-06
Chronic Lymphocytic Leukemia 2.345 5.1e-04
diabetes mellitus -1.200 6.1e-03
Down syndrome 1.100 9.3e-03
ependymoma 1.200 2.3e-03
facioscapulohumeral dystrophy -2.000 2.8e-02
glioblastoma 1.700 1.3e-04
group 4 medulloblastoma -1.100 1.1e-02
Hydrolethalus syndrome -1.986 3.4e-02
interstitial cystitis -1.100 4.3e-03
intraductal papillary-mucinous adenoma (... -2.100 1.2e-03
intraductal papillary-mucinous carcinoma... -2.300 6.6e-04
intraductal papillary-mucinous neoplasm ... -2.600 2.0e-03
lung adenocarcinoma -1.300 2.1e-06
lung cancer 1.700 1.7e-04
malignant mesothelioma -3.000 4.1e-09
nephrosclerosis 1.057 2.8e-04
non-small cell lung cancer -1.131 1.2e-09
oligodendroglioma 1.900 9.8e-11
osteosarcoma 1.578 4.8e-02
ovarian cancer -2.900 7.8e-12
pancreatic cancer 1.500 5.6e-03
Pick disease 1.100 3.6e-02
pituitary cancer -1.900 1.3e-03
primary pancreatic ductal adenocarcinoma 1.508 9.8e-03
tuberculosis -2.500 1.1e-05
X-linked cerebral adrenoleukodystrophy 3.100 3.8e-02

 GO Component (2)

Gene RIF (53)

AA Sequence

MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEIL      1 - 70
QRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELTPELVISNDKRSFCH                          71 - 119
//

Text Mined References (85)

PMID Year Title