Property Summary

NCBI Gene PubMed Count 80
PubMed Score 215.78
PubTator Score 143.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
ovarian cancer 8492 7.79666763569851E-12
oligodendroglioma 2849 9.7904200250498E-11
non-small cell lung cancer 2798 1.24255315112571E-9
malignant mesothelioma 3163 4.13132754883511E-9
pilocytic astrocytoma 3086 4.06147145125858E-7
posterior fossa group A ependymoma 1511 1.02816030966345E-6
atypical teratoid / rhabdoid tumor 4369 1.37905394753243E-6
lung adenocarcinoma 2714 2.12877424981294E-6
tuberculosis 1563 1.11392110784855E-5
glioblastoma 5572 4.92365506412671E-5
adult high grade glioma 2148 9.56315747965041E-5
lung cancer 4473 1.71394471580107E-4
nephrosclerosis 329 2.75345399789367E-4
chronic lymphocytic leukemia 244 5.05575004965227E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 6.61539563758074E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00119596668512229
pituitary cancer 1972 0.00131287986492706
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00202812054160422
active Crohn's disease 918 0.00376575604018433
interstitial cystitis 2299 0.00428205690049427
active ulcerative colitis 477 0.00502080379230279
pancreatic cancer 2300 0.00556435325709665
diabetes mellitus 1663 0.00608148401711613
astrocytic glioma 2241 0.00672456239930459
Down syndrome 548 0.00931238669566575
primary pancreatic ductal adenocarcinoma 1271 0.0097541591524489
group 4 medulloblastoma 1875 0.011046533674568
facioscapulohumeral dystrophy 286 0.0277419847797649
Hydrolethalus syndrome 128 0.033925036706202
Pick disease 1893 0.0361437498222747
X-linked cerebral adrenoleukodystrophy 115 0.037573535519035
osteosarcoma 7933 0.0481459988388981
Disease Target Count Z-score Confidence
Cancer 2346 3.756 1.9

Expression

Synonym

Accession Q02535 A8K1T8 O75641
Symbols HEIR-1
bHLHb25

Gene

ID3

PANTHER Protein Class (1)

PDB

2LFH  

  Ortholog (8)

Gene RIF (50)

PMID Text
26384138 Upon Id3 transfection, A549 cells displayed decreased migratory and invasive capabilities, however, co-transfection of miRId3 and Id3 into A549 cells reversed the Id3-induced inhibitions of migratory and invasive capabilities.
25778840 Inhibitor of differentiation 4 (ID4) acts as an inhibitor of ID-1, -2 and -3 and promotes basic helix loop helix (bHLH) E47 DNA binding and transcriptional activity.
25665868 ID3 has a role in the acquisition of molecular stem cell-like signature in microvascular endothelial cells
25239768 ID3 plays a potential role in the underlying regulatory mechanisms of metabolic health in human obesity. [Review]
25090023 our data provide evidence that ID3 may play a critical role in regulating vascular endothelial cell survival and development of microvascular lesions induced by persistent environmental pollutants such as PCB153.
24655651 Epigenetic changes in ID3, in combination with experiences of maltreatment, may confer risk for depression in children.
24603695 Data indicate association of inhibitor of differentiation 3 (ID3) single nucleotide polymorphism rs11574 directly with coronary artery pathology.
24493312 the combined immunohistochemical detection of VPREB3 and ID3 is applicable to the routine diagnostic in case of mature aggressive B-cell lymphomas.
24343358 study shows that Id2, Id3 and Id4 are each able to overcome TGF-beta dependence, and establish a role for Ids as key mediators of TGF-beta melanomagenesis
24292846 Importantly, the distinct ID3 expression patterns in acute leukemias (AL) indicate a specific deregulation of ID3 in the various types of AL and may support subtyping of AL.
More...

AA Sequence

MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEIL      1 - 70
QRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELTPELVISNDKRSFCH                          71 - 119
//

Text Mined References (82)

PMID Year Title
26384138 2015 Effects of upregulation of Id3 in human lung adenocarcinoma cells on proliferation, apoptosis, mobility and tumorigenicity.
25778840 2015 Inhibitor of differentiation 4 (ID4) acts as an inhibitor of ID-1, -2 and -3 and promotes basic helix loop helix (bHLH) E47 DNA binding and transcriptional activity.
25665868 2015 ID3 contributes to the acquisition of molecular stem cell-like signature in microvascular endothelial cells: its implication for understanding microvascular diseases.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25416956 2014 A proteome-scale map of the human interactome network.
25239768 2014 The potential role of inhibitor of differentiation-3 in human adipose tissue remodeling and metabolic health.
25090023 2014 PCB153-induced overexpression of ID3 contributes to the development of microvascular lesions.
24655651 2014 Child abuse, depression, and methylation in genes involved with stress, neural plasticity, and brain circuitry.
24603695 2014 A functionally significant polymorphism in ID3 is associated with human coronary pathology.
24493312 2014 The combined expression of VPREB3 and ID3 represents a new helpful tool for the routine diagnosis of mature aggressive B-cell lymphomas.
More...