Property Summary

NCBI Gene PubMed Count 5
Grant Count 16
R01 Count 15
Funding $3,808,550
PubMed Score 9.85
PubTator Score 7.08

Knowledge Summary

Patent

No data available

TINX Plot

Gene RIF (1)

PMID Text
24748133 calcium carbonate crystal growth data demonstrate that Otolin-1 and OC90 modulate in vitro calcite crystal morphology but neither protein is sufficient to produce the shape of otoconia

AA Sequence

MIAFLLTSVLMIPHAGGHPLDTPHLPQELPPGLPNNINITFFSGMFKNVESVAEIFDCLGPHFTWLQAVF      1 - 70
TNFPVLIQFVNGMKCVAGLCPRDFEDYGCTCRFEMEGLPVDESDSCCFQHRRCYEEAAEMDCLQDPAKLS     71 - 140
TEVNCVSKKIICESKDNCEHLLCTCDKAAIECLARSSLNSSLNLLDTSFCLAQTPETTIKEDLTTLLPRV    141 - 210
VPVEPTDTSLTALSGEVAAETEADRLITLSKKKAGHDQEGVGAARATSPPGSAEIVATRVTAKIVTLVPA    211 - 280
GIKSLGLAVSSVENDPEETTEKACDRFTFLHLGSGDNMQVMPQLGEMLFCLTSRCPEEFESYGCYCGQEG    281 - 350
RGEPRDDLDRCCLSHHCCLEQVRRLGCLLERLPWSPVVCVDHTPKCGGQSLCEKLLCACDQTAAECMTSA    351 - 420
SFNQSLKSPSRLGCPGQPAACEDSLHPVPAAPTLGSSSEEDSEEDPPQEDLGRAKRFLRKSLGPLGIGPL    421 - 490
HGR                                                                       491 - 493
//

Text Mined References (7)

PMID Year Title
24748133 2014 In vitro calcite crystal morphology is modulated by otoconial proteins otolin-1 and otoconin-90.
24556642 2014 Genome-wide association study of primary dentition pit-and-fissure and smooth surface caries.
16421571 2006 DNA sequence and analysis of human chromosome 8.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
10329003 1999 Intergenic splicing between a HERV-H endogenous retrovirus and two adjacent human genes.
9860971 1998 Otoconin-90, the mammalian otoconial matrix protein, contains two domains of homology to secretory phospholipase A2.
8382789 1993 Splicing of a human endogenous retrovirus to a novel phospholipase A2 related gene.