Property Summary

NCBI Gene PubMed Count 5
PubMed Score 9.85
PubTator Score 7.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Gene RIF (1)

PMID Text
24748133 calcium carbonate crystal growth data demonstrate that Otolin-1 and OC90 modulate in vitro calcite crystal morphology but neither protein is sufficient to produce the shape of otoconia

AA Sequence

MIAFLLTSVLMIPHAGGHPLDTPHLPQELPPGLPNNINITFFSGMFKNVESVAEIFDCLGPHFTWLQAVF      1 - 70
TNFPVLIQFVNGMKCVAGLCPRDFEDYGCTCRFEMEGLPVDESDSCCFQHRRCYEEAAEMDCLQDPAKLS     71 - 140
TEVNCVSKKIICESKDNCEHLLCTCDKAAIECLARSSLNSSLNLLDTSFCLAQTPETTIKEDLTTLLPRV    141 - 210
VPVEPTDTSLTALSGEVAAETEADRLITLSKKKAGHDQEGVGAARATSPPGSAEIVATRVTAKIVTLVPA    211 - 280
GIKSLGLAVSSVENDPEETTEKACDRFTFLHLGSGDNMQVMPQLGEMLFCLTSRCPEEFESYGCYCGQEG    281 - 350
RGEPRDDLDRCCLSHHCCLEQVRRLGCLLERLPWSPVVCVDHTPKCGGQSLCEKLLCACDQTAAECMTSA    351 - 420
SFNQSLKSPSRLGCPGQPAACEDSLHPVPAAPTLGSSSEEDSEEDPPQEDLGRAKRFLRKSLGPLGIGPL    421 - 490
HGR                                                                       491 - 493
//

Text Mined References (7)

PMID Year Title
24748133 2014 In vitro calcite crystal morphology is modulated by otoconial proteins otolin-1 and otoconin-90.
24556642 2014 Genome-wide association study of primary dentition pit-and-fissure and smooth surface caries.
16421571 2006 DNA sequence and analysis of human chromosome 8.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
10329003 1999 Intergenic splicing between a HERV-H endogenous retrovirus and two adjacent human genes.
9860971 1998 Otoconin-90, the mammalian otoconial matrix protein, contains two domains of homology to secretory phospholipase A2.
8382789 1993 Splicing of a human endogenous retrovirus to a novel phospholipase A2 related gene.